Details for Lyrate rockcress Locus 16043896

Position : sca3 ( 5`- 10844250 .. 10850175 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043896

Protein [Map View]
MVVPGRRTVWDCVIELTKMAQENCIDPRLWASQLSSNLKFFAVELPSTELAEVIVSYICWDNNVPILWKFLERAMALKLV
SPLVVLALLSHRVVPSRCTQVAAYRIYLELLKRNMFTIKVHISGPHYQKVMISVANVLRLSKLFDLETSKPGVLLVEFVF
KMVLQLLDATLSDEGLLELSQDSSSQWLVKSQEMEIDAPERYNEKTGSLEMLQSLNTIMAIELIAEFLRNTVISRLLYLV
SSNRASNWHEFVQKVQLLGENSSALKNSKVLNSGDLLQLISSRRFGYSCDIKVTSSRKSNAIVDFGSLSSFAGLCHGASL
SSLWLPLDLVFEDAMDGYQVNPTSAIEIITGLAKTLKEINGSTWHDTFLGLWIAALRLVQRERDPIEGPIPRLDTRLCMS
LCIVPLVVANLIEERKYVSVMEKLRNDLITSLQVLGDFPGLLAPPKCVVSAANKAATKAILFLSGGNVGKSCSDVINMKE
MPINCSGNMRHLIVEACIARNILDTSAYSWSGYVNGRINQIPQSLPNEVPCWSSFVKGAQLNAAMVNALVSVPASSLAEL
EKLYEVAVKGSDDEKISAATVLCGASLTRGWNIQEHTVEFLTRLLSPPVPADYSSAENHLIGYACMLNVVIVGIGSVDCI
QIFSLHGMVPQLACSLMPICEEFGSYSPSVSWTLPSGEQVSAYSVFSNAFTLLLKLWRFNHPPIEHGVGDVPTVGSQLTP
EHLLSVRNSYLVSSETLDRDRNRKRLSEVARAASCQPVFVDSFPKLKIWYRQHQRCIAATLSGLTHGSPIHQTVEALLNM
TFGKVRGSQTLNPVNSGTSSSSGAASEDSNTRPAFPAWDILKAVPYVVDAALTACTHGRLSPRQLATGLKDLADFLPASL
ATIVSYFSAEVSRGVWKPVFMNGVDWPSPATNLSTVEEYITKILATTGVDIPSLAPGGSSPATLPLPLAAFVSLTITYKI
DKASERFLNLAGPALECLAAGCPWPCMPIVASLWTQKAKRWFDFLVFSASRTVFLHNQDAVIQLLRNCFSATLGLNAAPM
SNDGGVGALLGHGFGSHFYGGISPVAPGILYLRMYRALRDTVSVSEEILSLLIHSVEDIAQNRLSKEKLERLKTVKNGTR
YGQSSLATAMTQVKLAASLSASLVWLTGGLGVVHLLIKETIPSWFLSTDKSDREQRPSDLVAELRGHALAYFVVLCGAFA
WGVDSRSTASKRRRQAILGSHLQFIASVLDGKISVGCETATWRAYISGLVSLMVSCLPLWVTEIDTEVLKSVSSGLRKWG
KEELAIVLLSLGGLRTMDYAADFIIHLRS*

DNA
ATGGTGGTTCCTGGACGGAGAACCGTCTGGGATTGTGTGATTGAGCTAACAAAGATGGCTCAAGAAAACTGTATCGATCC
TCGTCTTTGGGCTTCTCAGTTATCATCGAATTTGAAATTCTTCGCCGTCGAGTTACCGTCGACGGAGCTCGCGGAGGTTA
TCGTCTCGTACATTTGTTGGGATAATAACGTTCCTATTCTTTGGAAGTTTCTCGAAAGAGCTATGGCTTTGAAGCTTGTT
TCTCCTCTCGTTGTTCTTGCTCTGCTCTCTCACAGAGTTGTTCCAAGCCGGTGTACGCAAGTAGCGGCTTATAGAATTTA
CTTGGAGCTGCTCAAGAGAAATATGTTCACTATTAAAGTTCATATTAGTGGACCTCACTACCAGAAGGTCATGATTTCAG
TAGCCAACGTTCTTCGTCTTTCAAAGTTATTTGATTTGGAAACAAGCAAACCTGGTGTGCTTTTAGTAGAATTTGTTTTC
AAGATGGTGTTACAACTGCTAGATGCAACTTTAAGCGATGAAGGTTTGCTAGAGCTAAGCCAAGACTCGAGCTCCCAGTG
GCTAGTTAAGTCTCAAGAAATGGAAATTGATGCTCCTGAGAGATATAATGAAAAGACTGGATCGCTAGAGATGTTACAGT
CTTTGAATACCATCATGGCTATCGAGTTGATTGCGGAGTTCCTCAGAAATACTGTGATATCCAGATTGCTATACTTGGTA
TCTTCCAACAGGGCTTCGAATTGGCATGAATTTGTTCAGAAAGTTCAGCTGCTTGGAGAAAATTCATCGGCTTTAAAAAA
CTCAAAGGTTCTAAATTCTGGGGATCTATTGCAGTTGATATCAAGTAGACGATTTGGGTATTCTTGTGACATCAAAGTAA
CTTCATCACGGAAATCTAATGCAATAGTGGATTTTGGATCTCTCTCTTCCTTTGCTGGCTTATGCCATGGAGCAAGTCTC
TCTTCACTTTGGCTTCCTCTTGATCTAGTATTTGAAGATGCAATGGATGGATATCAAGTAAACCCAACTAGTGCAATTGA
AATCATTACCGGTCTAGCTAAAACACTTAAAGAAATTAATGGGAGTACTTGGCATGACACTTTCTTGGGGCTTTGGATAG
CAGCTCTCCGACTTGTTCAAAGGGAAAGGGATCCTATTGAGGGACCTATTCCTCGACTGGACACAAGGCTGTGCATGTCA
TTATGTATTGTGCCTCTTGTGGTCGCAAACCTTATTGAAGAGAGGAAATACGTATCTGTCATGGAAAAGCTGCGAAATGA
TCTTATTACAAGTTTGCAAGTCCTCGGTGATTTCCCTGGATTGCTGGCTCCTCCCAAGTGTGTTGTTTCTGCTGCCAACA
AGGCTGCTACGAAGGCAATCTTGTTTTTGTCTGGTGGCAATGTTGGGAAGTCGTGTTCTGATGTCATAAACATGAAGGAA
ATGCCTATCAACTGCTCTGGAAACATGCGCCACCTGATAGTCGAGGCTTGTATTGCAAGAAACATACTGGATACGTCGGC
CTATTCGTGGTCTGGCTATGTCAATGGCCGAATCAACCAAATACCTCAGAGTCTGCCGAATGAAGTACCCTGCTGGTCTT
CATTTGTGAAAGGGGCCCAACTAAATGCTGCAATGGTGAATGCATTAGTTTCAGTTCCTGCTTCAAGCTTAGCAGAGCTC
GAGAAACTATATGAGGTTGCAGTCAAAGGATCGGATGACGAGAAGATATCTGCTGCTACAGTTCTTTGTGGGGCATCTCT
CACACGGGGTTGGAACATACAGGAACACACTGTTGAGTTTCTTACAAGATTACTATCCCCACCCGTTCCAGCAGATTATT
CCAGTGCTGAAAATCATTTGATTGGTTATGCCTGCATGCTGAATGTTGTTATTGTTGGGATAGGATCTGTTGACTGCATT
CAGATTTTCTCTTTACATGGCATGGTTCCGCAACTTGCTTGCTCACTAATGCCAATCTGTGAAGAGTTTGGATCTTACTC
CCCGAGTGTATCATGGACTCTTCCTTCCGGAGAACAAGTATCAGCCTATTCTGTTTTCTCAAATGCATTCACTCTTCTTT
TAAAGCTTTGGAGATTCAATCATCCTCCTATTGAGCATGGTGTAGGAGATGTTCCCACAGTTGGTTCCCAACTCACTCCT
GAACATCTTCTTTCAGTGCGTAATTCTTATCTTGTTTCGTCGGAGACCCTTGATAGAGACCGAAACAGAAAGAGACTTTC
AGAAGTTGCAAGGGCAGCATCTTGCCAGCCCGTGTTTGTTGACTCGTTCCCCAAGCTAAAAATCTGGTATAGGCAGCACC
AAAGATGCATAGCTGCCACATTATCTGGACTTACACATGGATCTCCCATTCATCAGACAGTTGAAGCACTTCTCAACATG
ACGTTCGGAAAGGTCAGAGGCAGTCAGACTTTAAATCCAGTAAATTCGGGCACAAGCAGTTCATCAGGAGCTGCAAGTGA
AGATAGCAATACAAGACCTGCGTTTCCTGCTTGGGATATCCTCAAAGCCGTTCCATATGTTGTAGATGCTGCTTTAACTG
CTTGTACTCATGGAAGGCTTTCGCCTCGTCAGTTAGCTACAGGGCTGAAAGACTTAGCAGATTTTCTCCCGGCATCATTA
GCAACGATAGTAAGCTATTTCTCAGCTGAGGTGAGTAGAGGTGTTTGGAAGCCAGTATTCATGAACGGCGTGGATTGGCC
AAGTCCAGCTACAAATCTATCCACTGTTGAGGAATATATAACGAAAATTCTTGCAACAACAGGCGTCGATATCCCTAGCC
TTGCTCCAGGAGGGAGTTCACCGGCAACACTTCCTTTACCTTTAGCCGCCTTTGTAAGTCTAACCATTACTTACAAAATT
GACAAAGCCTCAGAGCGGTTTCTCAACCTGGCTGGCCCAGCTCTTGAGTGCTTGGCTGCAGGCTGCCCTTGGCCTTGCAT
GCCCATTGTAGCTTCATTATGGACCCAAAAGGCGAAACGTTGGTTTGACTTCCTTGTTTTCTCTGCCTCTCGCACCGTCT
TCCTTCACAACCAAGACGCTGTGATTCAGCTCCTCAGAAACTGCTTCAGTGCCACTCTCGGTTTGAATGCTGCCCCCATG
TCAAATGATGGTGGCGTTGGAGCTCTTCTTGGCCATGGATTTGGCTCTCATTTCTATGGCGGGATCTCTCCTGTAGCACC
AGGGATTCTTTATCTCCGTATGTATCGTGCTCTCAGAGATACTGTCTCTGTATCGGAAGAGATTCTCTCTCTGCTGATAC
ATTCGGTGGAGGATATAGCCCAGAACAGGCTCTCAAAGGAGAAGCTGGAAAGGCTGAAGACAGTGAAGAACGGAACAAGA
TACGGCCAAAGTTCTCTAGCAACAGCAATGACTCAAGTCAAGCTTGCTGCTTCGCTTAGTGCCTCGTTGGTATGGCTAAC
CGGTGGCTTAGGTGTGGTCCACCTACTCATCAAAGAAACCATCCCGTCTTGGTTTCTATCAACTGACAAATCAGACCGAG
AACAAAGACCATCAGATCTAGTTGCAGAGCTAAGAGGTCATGCCCTTGCCTACTTTGTAGTCCTATGTGGAGCATTTGCT
TGGGGGGTGGACTCAAGATCAACTGCATCAAAACGCCGCCGCCAAGCAATCTTGGGAAGCCACTTGCAGTTCATCGCGAG
TGTCTTAGACGGGAAAATATCAGTGGGATGCGAAACAGCAACTTGGCGGGCATATATTTCCGGTTTGGTGAGTCTAATGG
TGAGCTGTTTGCCTCTCTGGGTGACAGAGATCGATACAGAAGTGTTAAAGAGTGTAAGCAGTGGACTAAGAAAATGGGGA
AAAGAAGAGCTAGCGATTGTATTACTCTCCTTGGGAGGTCTCAGAACAATGGACTACGCAGCTGATTTCATCATTCATTT
GCGTTCATAG