Details for Lyrate rockcress Locus 16043865

Position : sca3 ( 5`- 6609909 .. 6612313 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043865

Protein [Map View]
MASCSLGVPKIKISAVDLSRVRSASFLIPYNQKSLLGQRPVKYLSLRTTFGSVKAVQLSTVPAAETSATIEVKDSEETKS
SRLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLYVARNIADNSSPQPPPTPAVAASNATTESPDLNGSASSTSL
AISKPASSAADQGLMILQSPKVGFFRRSKTIKGKRLPSSCKEKDLVKEGQILCYIEQLGGQFPIEADVTGEVVKILREDG
EPVGYNDALISILPSFPGIKKLQ*

DNA
ATGGCTTCATGTAGCCTAGGAGTTCCTAAAATTAAAATCTCAGCAGTAGACCTTAGTAGAGTAAGATCTGCAAGCTTTCT
GATACCATACAATCAAAAATCATTGCTTGGGCAAAGGCCGGTGAAGTACTTGAGCCTGAGGACAACGTTTGGGTCTGTGA
AAGCTGTCCAACTGTCTACTGTCCCAGCTGCAGAAACATCAGCTACTATAGAAGTAAAAGATTCTGAAGAGACCAAGTCA
TCTCGATTGAACGCTCAGCTCGTTCCCAAGCCCTCTGAGGTGGAAGCCCTTGTCACTGAAATATGCGATTCTTCATCAAT
TGCAGAGTTTGAACTGAAACTGGGGGGTTTCCGACTATATGTAGCAAGGAACATAGCTGACAATAGTAGTCCACAACCTC
CGCCAACTCCTGCTGTAGCTGCTTCAAATGCAACTACCGAGAGTCCTGATTTGAATGGATCAGCTTCCTCTACTTCACTG
GCTATCTCAAAACCAGCATCGTCAGCCGCTGATCAGGGTTTGATGATTCTCCAATCTCCAAAAGTAGGGTTCTTCAGGAG
ATCCAAAACCATAAAGGGTAAACGCCTGCCTTCGTCTTGTAAAGAGAAAGACCTAGTGAAAGAAGGTCAAATTCTGTGCT
ACATTGAACAACTCGGTGGCCAATTTCCAATCGAGGCTGATGTTACCGGCGAGGTAGTCAAGATACTTCGAGAAGATGGA
GAGCCTGTAGGATACAATGATGCTCTCATCTCCATCCTTCCATCCTTTCCGGGGATCAAGAAGCTTCAGTAA