Details for Lyrate rockcress Locus 16043839

Position : sca3 ( 5`- 4169138 .. 4172750 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043839

Protein [Map View]
MVRATVLNVGDHAGEGVPINKAKGEKMVLEPPMNSAQRRKLGDITNLQNQKNLMNQGAKQQKQAILENMRLMKVVTERDG
IKSELKKLRIDFQKVQEQNLLLAQANARILALKVLQHELGCKNGLVMARKLLLKAHANACGGACRTFQPNDADHENASES
SNVNSLQINEKANNKRRVSGRKNPTNSEVLDIIDRLAETCPTEDNIDNKKLSASFKTRATGQTVNLQKVVDTRENKEDAR
VSLKKHPDWVKSQEPEPSENPYESSRFPLRRRSARLKSQEPEPSESLHESIETTRRKRSTISVRQSGMFNIQELGVIQNL
NGLHDDQEIAAKAGCSVRELSTGSKPEAVEPHDSKQITGKSRVSLRRQSARFNFQELCVTENLNGPHNDQTIAANARCCA
SEQSIRSKHKAVEPHDMKETIGKSRVSSRRQSANIETPRAIKESADPPLHDDIIEESSHVSSSVSMELKRESKNKPTCDE
SEEMRKTTVGRPSRQAAEKIKSYKEPSLKEKMRGGF*

DNA
ATGGTTCGCGCGACGGTTCTAAATGTCGGTGATCATGCCGGTGAAGGTGTGCCTATTAACAAAGCTAAAGGAGAGAAAAT
GGTTCTGGAACCTCCGATGAACAGTGCACAAAGACGAAAATTGGGGGATATTACTAATTTGCAGAATCAGAAGAATCTAA
TGAATCAGGGAGCGAAGCAGCAGAAACAAGCTATATTAGAAAACATGAGACTGATGAAAGTCGTCACTGAGAGAGATGGA
ATCAAAAGTGAGCTGAAGAAACTTAGGATTGACTTTCAGAAGGTTCAAGAACAAAATTTGCTACTTGCCCAGGCAAACGC
TCGTATCTTGGCGCTGAAGGTACTTCAGCACGAACTTGGTTGCAAGAATGGGTTAGTCATGGCCAGGAAATTACTGCTTA
AGGCTCATGCAAATGCTTGTGGTGGGGCTTGCAGAACCTTTCAGCCAAATGACGCAGATCATGAGAATGCTTCAGAGAGC
TCTAACGTTAACTCATTGCAAATAAATGAGAAAGCCAACAATAAAAGGAGAGTTTCTGGAAGGAAGAATCCTACCAATTC
CGAAGTATTAGATATTATTGATAGACTGGCAGAGACATGTCCGACAGAAGACAACATTGACAACAAGAAATTGTCTGCCA
GTTTTAAAACTCGAGCCACTGGCCAAACGGTAAACTTGCAAAAAGTGGTTGACACCAGAGAAAATAAGGAGGATGCAAGG
GTTTCTTTGAAAAAGCATCCTGACTGGGTAAAATCTCAAGAACCTGAGCCATCTGAAAACCCATACGAGTCAAGCAGGTT
CCCTTTGAGAAGGCGTTCTGCCCGGTTAAAATCTCAAGAACCTGAGCCATCTGAAAGCCTCCATGAGTCAATAGAGACAA
CCAGGAGGAAGAGGTCTACAATAAGCGTTAGGCAGTCTGGGATGTTCAATATCCAAGAGCTGGGCGTTATTCAGAACTTG
AATGGTTTACATGATGATCAAGAGATTGCTGCAAAGGCCGGATGCTCTGTGCGTGAACTGTCTACCGGGTCTAAACCCGA
AGCAGTAGAACCACATGACTCAAAACAGATAACCGGGAAAAGCAGGGTATCTTTGAGAAGACAGTCTGCGAGGTTTAATT
TCCAAGAGCTGTGCGTGACTGAAAACTTGAATGGTCCACATAATGATCAAACGATTGCTGCAAATGCCAGATGCTGTGCA
AGTGAACAGTCTATCAGGTCTAAACACAAAGCAGTAGAACCACATGACATGAAAGAGACAATCGGGAAAAGCAGAGTCTC
TTCAAGAAGACAATCTGCAAACATTGAAACTCCGAGAGCCATCAAAGAATCCGCAGATCCGCCTTTGCATGATGACATTA
TTGAGGAGTCTAGTCATGTATCATCATCGGTTTCAATGGAGCTTAAAAGAGAATCAAAGAACAAACCAACATGCGATGAA
TCAGAGGAGATGAGAAAAACAACTGTTGGAAGACCTTCAAGGCAAGCTGCTGAAAAAATCAAATCGTACAAGGAACCCTC
ACTTAAGGAGAAGATGCGAGGGGGCTTCTGA