Details for Lyrate rockcress Locus 16043822

Position : sca3 ( 5`- 8101737 .. 8103578 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043822

Protein [Map View]
MKCLKDGFLHHIRSIKTGSTLTTISSNQLVNLYSKNGLLREARNVFDEMPERNVYSWNAVIAAYVKFNNVKEARELFKRD
NCERDLITYNTLLSGFAKTDGCESEAIKMFGEMHRKEKDEIWIDDFSVTTMVKLSAKLTNVFYGEQLHGVMVKTGNDATK
FSVSSLIHMYSKCGKFKEVCNVFNGSCVEFVDSVARNAMIAAYCREGDIDKALSIFWRNPELNDTISWNTLISGYAQNGY
EEEALKIAVSMEESGLKWDEHTFAAVLNVLSSLKSLKIGKEVHARLLKNGSYSNKFVSSGIVDVYCKCGNMKYAESAHLL
YGFGNLYSTSSMIVGYSSQGKMGEAKRLFDSLSEKNLVVWTAMFLGYLNLRQPDSVLELARDFIANETNVPDSLVMVSVL
GACSLQAYMEPGKEIHGHSLRTGILMDKKLVTAFVDMYSKCGNVEYAERIFDISFERDTVMYNTMIAGYAHHGHEAKSFQ
LFEDMTEGGFKPDEITFMALLSACRHRGLVLAGEKYFKSMIEAYNISPEAGHYTCMIDLYGKANRLDKAIELMEGIDQVE
KDAVILGAFLNACSWNKNTELVKEVEEKLLAIEGSNGSRYIQLANAYASSGRWD

DNA
ATGAAGTGCTTAAAGGATGGGTTTTTGCATCACATTCGCTCCATTAAAACTGGTTCAACCTTGACCACAATCTCCTCAAA
CCAACTCGTTAACCTTTACTCAAAAAATGGCTTATTGCGGGAAGCACGGAATGTGTTCGACGAAATGCCTGAGAGAAACG
TTTACTCGTGGAACGCTGTGATTGCAGCTTACGTAAAGTTCAACAACGTAAAGGAAGCGCGTGAATTGTTCAAAAGGGAC
AATTGTGAACGAGATTTGATTACGTACAACACTTTGCTTTCAGGGTTTGCCAAAACTGATGGGTGTGAGAGTGAAGCTAT
TAAGATGTTTGGTGAGATGCATAGAAAGGAGAAGGATGAGATTTGGATAGATGATTTCAGTGTCACTACTATGGTTAAGC
TTTCTGCGAAGTTAACCAATGTGTTTTATGGCGAACAGTTGCATGGAGTTATGGTGAAAACCGGGAATGATGCAACTAAG
TTTTCTGTTAGTTCTCTCATTCACATGTATTCAAAATGTGGGAAGTTTAAGGAAGTTTGTAATGTCTTTAACGGGTCGTG
TGTTGAGTTTGTTGATAGTGTGGCTAGGAACGCAATGATTGCAGCTTATTGTAGAGAAGGTGACATTGACAAAGCTTTGA
GTATATTCTGGAGAAATCCAGAATTGAATGATACAATTTCTTGGAATACATTGATCTCAGGGTATGCACAGAATGGTTAT
GAAGAAGAAGCTTTGAAGATAGCTGTTAGTATGGAGGAAAGTGGGTTGAAATGGGACGAACACACTTTCGCGGCTGTACT
AAATGTTCTGAGTAGTTTAAAGAGCCTGAAGATTGGAAAGGAAGTACATGCTCGGTTATTGAAGAACGGATCATATTCTA
ATAAATTTGTAAGCAGTGGAATTGTTGATGTTTATTGCAAGTGTGGAAATATGAAGTATGCAGAGTCTGCTCATTTGTTA
TATGGTTTTGGAAACTTGTATTCAACTTCTTCAATGATCGTGGGCTACTCGTCTCAGGGGAAGATGGGGGAGGCGAAAAG
GTTGTTTGATTCTTTATCTGAAAAGAATCTAGTGGTCTGGACTGCCATGTTCTTGGGATATCTTAATTTACGTCAACCTG
ATTCTGTTTTGGAACTTGCTCGTGATTTTATAGCCAATGAGACCAATGTTCCTGATTCTTTGGTCATGGTCAGCGTCCTT
GGTGCATGCTCTTTACAAGCTTATATGGAACCAGGGAAGGAGATTCACGGTCACAGCTTGAGAACAGGCATTTTAATGGA
TAAAAAACTTGTTACTGCATTTGTTGACATGTATTCAAAATGTGGAAATGTTGAGTATGCTGAAAGGATCTTTGACATTA
GCTTCGAGAGAGACACAGTTATGTACAACACAATGATAGCTGGTTATGCTCATCATGGCCATGAAGCCAAATCTTTTCAG
CTCTTTGAAGACATGACTGAGGGTGGATTCAAGCCAGATGAAATCACGTTTATGGCCCTCCTATCAGCTTGTCGTCACCG
CGGCTTAGTTCTAGCAGGTGAGAAATACTTTAAGTCGATGATAGAGGCTTACAACATATCCCCCGAGGCAGGTCACTATA
CCTGCATGATAGATTTGTATGGAAAGGCCAATAGATTGGACAAAGCCATAGAACTTATGGAAGGTATTGATCAAGTTGAA
AAAGATGCTGTTATTCTTGGAGCGTTTTTAAATGCTTGTAGTTGGAATAAGAATACAGAGCTTGTGAAGGAAGTGGAAGA
GAAATTGTTAGCCATTGAAGGATCTAACGGGTCTCGCTATATCCAACTAGCTAACGCTTATGCCTCGTCTGGTAGATGGG
AT