Details for Lyrate rockcress Locus 16043767

Position : sca1 ( 5`- 29174511 .. 29175080 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043767

Protein [Map View]
MTNYNAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISRIKTNLGYFRANYAIGVLFIL
FLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQIDDRTVLIGLSVFTVVMLLLTHATSNILGSLLTAAVLVLIHA
AVRRSDNLFLDEEAAAVSESSGLMSYPSS*

DNA
ATGACGAACTACAACGCGATTCCGACGTCGTCTCATCCATCACCGGCGATAGATCTCGAATACATCTCACGCGCCAAACA
CCGTATAAAATCCGGTCTGGCCACGCGCCGGCCATGGAAATCGATGTTCGATTTCGAATCAATGACTCTCCCACACGGTT
TCTTCGACGCGATCTCGAGAATCAAAACGAATCTCGGCTATTTCAGAGCTAATTACGCCATCGGAGTTCTCTTCATCCTC
TTCCTAAGCCTTCTCTATCACCCAACGTCGTTAATCGTGTTATCAATCTTGGTCGTCTTCTGGATCTTTCTCTATTTCCT
CCGTGACGAGCCTCTTGTGGTTTTCGGTTATCAGATTGATGATCGGACGGTTCTCATTGGTTTATCGGTTTTCACGGTTG
TGATGCTTTTGTTGACTCACGCTACGTCGAATATTCTGGGATCTTTGTTAACCGCCGCCGTGTTGGTTCTGATTCATGCG
GCGGTTAGAAGAAGTGATAATTTGTTTCTTGATGAAGAAGCTGCGGCGGTTTCTGAATCTTCAGGGCTTATGTCATACCC
TTCGTCATAA