Details for Lyrate rockcress Locus 16043763

Position : sca3 ( 5`- 4074285 .. 4076414 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043763

Protein [Map View]
MATSRLQLEGDDSVHLHITHANLKSFSADVRFSPQMSVEAVKEKLWKKCGTSVNSMALELYDDSGSKVAVLSDNSRPLGF
FSPFDGFRLHIIDLDPSSVTTGGWLEDTSLVEKYNISEEDYAKRTDSFRKFKEKRVSQIPAAAEAKTKENYMEDLCANIK
VGDRCQVEPGEKRGMVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRFFECPPLQGGMVRPDKVKVGDYPERDPFEE
DEI*

DNA
ATGGCAACTTCGCGTTTACAGTTGGAAGGAGATGACTCTGTTCATCTACACATTACTCATGCCAACCTTAAAAGCTTCTC
TGCGGATGTTCGTTTCTCTCCACAAATGAGTGTAGAAGCTGTGAAAGAAAAGCTATGGAAGAAATGTGGTACATCTGTTA
ATTCCATGGCTTTAGAGCTCTATGATGACTCTGGCTCAAAGGTTGCAGTTCTCAGTGATAATTCAAGACCTCTCGGTTTC
TTCTCCCCTTTTGATGGGTTTCGCTTGCACATCATAGATCTTGACCCGTCGTCAGTCACAACTGGAGGCTGGCTTGAAGA
TACATCACTGGTTGAGAAGTATAACATCTCAGAGGAGGATTATGCTAAACGAACTGACAGTTTTAGGAAATTCAAAGAAA
AAAGAGTGTCTCAAATTCCGGCTGCTGCTGAGGCTAAGACGAAGGAGAACTATATGGAAGATCTCTGTGCGAATATCAAG
GTGGGAGATAGATGCCAAGTTGAGCCTGGGGAGAAAAGAGGAATGGTCAAATATGTTGGACGAGCAGAGTCGTTGGGTCC
TGGCTATTGGGTTGGAATTCAGTATGATGAACCCCTTGGAAAACATGATGGCATGGTGAAAGGAACAAGATTCTTTGAGT
GCCCTCCGCTTCAAGGTGGTATGGTCAGGCCTGACAAAGTAAAGGTTGGTGATTATCCGGAAAGAGACCCTTTCGAGGAA
GATGAAATATAA