Details for Lyrate rockcress Locus 16043716

Position : sca3 ( 5`- 7523963 .. 7525143 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043716

Protein [Map View]
MSYTFFLLLLTLVHSTFSSLAPTDRAALQSIRDSLTDMPGSAFFSSWDFTVPDPCSSFSGLTCSSLGRVTGLTLGPNLSG
SLSPSISILTHLNQLILYPGSVTGPLPPRFDSLPLLRVISLTRNRLTGPIPVSFSSLSNLHTLDLSYNQLSGSLPPFLTT
LPRLKVLVLASNHFSNNLKPVSSPLFHLDLKMNQISGQLPPAFPITLRHNSISGELPPALVGAEALFLNNNRLTGDIPEE
YVKSLVNGTTKQLFLQHNYFTRFPWNSGLQLPDSVSLCLSYNCMETDPVVGLSTCPIEVAPLLSRPASQCSRFYNHSSTG
*

DNA
ATGAGCTACACTTTCTTTCTCCTTCTGCTCACTCTCGTCCACTCCACTTTCTCTTCATTAGCTCCTACGGATCGAGCCGC
GCTCCAATCCATCAGAGACTCTTTAACCGACATGCCTGGTTCAGCCTTCTTCTCCTCTTGGGACTTCACAGTCCCTGACC
CTTGTTCCTCCTTCTCTGGCCTTACCTGCTCTTCTCTCGGCCGTGTCACCGGCTTAACTCTTGGCCCTAATCTCTCAGGT
TCTCTCTCCCCTTCCATCTCCATTCTAACACACTTAAACCAACTCATTCTCTACCCTGGCTCAGTCACCGGTCCTCTCCC
TCCTCGGTTCGATTCCCTCCCTCTCCTTAGAGTCATTTCCTTAACAAGAAACCGCTTAACCGGTCCTATACCAGTTTCTT
TCTCATCTCTCTCAAACCTCCACACTCTTGACCTTAGCTATAACCAACTCTCAGGCTCTCTCCCTCCGTTTCTCACTACT
CTTCCTCGACTCAAAGTCCTTGTTTTAGCCTCAAACCATTTCTCCAACAACCTTAAACCTGTCTCTAGCCCATTGTTCCA
TTTAGACCTAAAGATGAACCAAATCTCCGGCCAACTCCCACCCGCTTTCCCCATCACTCTCCGCCATAACTCAATCTCCG
GAGAGTTACCTCCCGCGCTCGTCGGAGCAGAGGCTCTGTTCTTGAACAATAACCGTCTCACAGGAGACATTCCAGAGGAA
TACGTCAAGAGCTTAGTCAACGGTACAACAAAACAGCTCTTCTTGCAACATAACTACTTCACGAGATTCCCTTGGAACTC
TGGTCTCCAACTACCAGACTCTGTTTCGCTCTGTTTGTCATATAACTGTATGGAGACAGATCCAGTCGTTGGTTTGTCCA
CGTGTCCGATCGAAGTTGCACCTCTGCTCTCAAGACCTGCTTCACAATGTTCAAGATTCTATAATCACAGCTCCACTGGC
TAA