Details for Lyrate rockcress Locus 16043712

Position : sca3 ( 5`- 1129091 .. 1128432 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477605 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043712

Protein [Map View]
MTIHAAVIQKLLNTGAHLGRRAAEHHFKQYAYGTRNGMTIIDSDKTLICLRSAAHFVANLAHMRGNIFFVNTNPLFDEII
ELTSRRIQGDSYNHNRAMNLWKMGGFLTNSYSPKKFRSRHKKLCFGPTTMPDCVVVFDTERKSSVILEASKLQIPVVAIV
DPNVPLEFFEKITYPVPARDSVKFVYLFCNVITKCFVAEQMKLGIKDGSKEDMMKDLAA*

DNA
ATGACGATTCACGCTGCAGTAATCCAGAAGCTTCTGAACACCGGAGCACATCTTGGCCGTCGCGCCGCCGAGCACCATTT
CAAGCAATACGCTTACGGGACGCGTAACGGAATGACCATTATCGACTCCGACAAAACCCTAATTTGCCTCCGTAGCGCCG
CTCATTTCGTCGCTAACCTCGCCCACATGAGAGGTAACATCTTCTTCGTTAACACAAACCCTCTCTTCGACGAAATCATT
GAGCTCACTTCTCGTCGGATCCAAGGCGATTCGTATAATCACAACCGTGCGATGAATCTATGGAAGATGGGTGGGTTTTT
GACTAACAGTTACAGTCCTAAGAAGTTTCGATCTAGGCACAAAAAGCTTTGCTTTGGTCCTACTACTATGCCTGATTGTG
TCGTTGTGTTTGATACTGAGAGGAAGAGTTCTGTGATACTTGAGGCCTCGAAGCTTCAGATTCCGGTTGTTGCAATTGTG
GATCCGAATGTTCCATTGGAGTTCTTTGAGAAGATTACGTATCCTGTGCCAGCTCGTGATTCGGTCAAGTTTGTGTATTT
GTTCTGTAATGTGATCACCAAGTGCTTTGTGGCAGAACAGATGAAGTTGGGGATCAAAGATGGGAGCAAAGAAGATATGA
TGAAGGATTTAGCTGCTTGA