Details for Lyrate rockcress Locus 16043710

Position : sca3 ( 5`- 6570746 .. 6573313 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043710

Protein [Map View]
MGISQQDNFSMLQSNSAGGVEKPDFKWGAKRGVGRKDNKVRFYESFTYDGIEYWLFDCAYFYIHGQCETSIGKLVSMYET
SAGEKKVKVIWFFRPIDIHRFLGDYEPQWDELFLACGDEKGVSNINDVETIMGKCNVVCTSEDRRNPRPGSNELRRANYV
FSRTFDTILRIISEDFADAIAGIGVDKLFNMRRDKQPVKRVNSSAAASTRASPVKHFRPDLGSTKLGKNDNRDGKLMSRT
SSLKKVSFLEDRAGHVHVKKNPPINTDTTSRGPILKTRAFGELYASGSSVDAKPSKKRKLILNTPETDDSDDPGPQSGEK
KIMKNPPLIEKAPSQNIEKKSWYKKLPFEDELKPAIEKGRVLLIENLEPSYTSLEVEDLCRQAFKEAVDAKMIPSSLVSS
PHSGICRALVIFGTTKAADSAMSQLTEKCLMLPGQRPLLGSKKVPLEIGRCRSFTGHFSMVDRSMMTTQKVSCCISHVKD
FSCFNSLKIPEYKTLSHTILFF*

DNA
ATGGGAATATCACAGCAGGATAACTTCTCTATGTTGCAATCGAATAGTGCCGGTGGAGTAGAGAAACCTGATTTTAAGTG
GGGTGCTAAGAGAGGGGTGGGTCGGAAAGATAATAAAGTCCGGTTCTATGAATCATTTACCTATGACGGCATCGAGTACT
GGCTTTTTGACTGTGCTTACTTTTACATACATGGTCAATGTGAGACTTCAATTGGGAAGCTTGTCAGCATGTACGAGACA
TCAGCAGGTGAGAAGAAAGTCAAGGTCATTTGGTTTTTTCGACCTATCGACATCCATCGCTTCTTGGGAGACTATGAGCC
ACAATGGGATGAGTTGTTTCTGGCTTGTGGTGATGAAAAAGGGGTTTCCAATATCAATGATGTCGAGACCATCATGGGGA
AATGCAATGTTGTATGCACATCTGAGGACCGAAGAAATCCACGACCAGGAAGCAATGAGTTGAGGAGAGCTAACTATGTC
TTCTCCCGCACCTTCGATACAATACTGAGAATTATATCAGAAGACTTTGCAGATGCTATAGCTGGAATTGGAGTGGATAA
ACTCTTCAACATGAGAAGAGATAAACAGCCTGTAAAACGTGTAAACTCAAGCGCAGCTGCCAGTACTAGGGCTTCTCCAG
TTAAACATTTTCGTCCAGATTTGGGATCAACAAAGTTAGGAAAAAATGATAACAGAGATGGAAAGCTGATGAGTAGAACA
AGCTCGTTAAAGAAAGTCTCTTTTCTGGAGGACCGTGCTGGTCATGTACATGTGAAGAAAAACCCTCCTATCAATACTGA
TACCACGTCAAGAGGTCCGATACTCAAAACCAGAGCATTTGGGGAGTTATATGCTTCAGGTTCATCAGTCGATGCTAAGC
CTTCTAAAAAGAGGAAGCTTATACTCAACACACCAGAAACAGATGATTCAGATGATCCAGGCCCTCAATCAGGAGAGAAG
AAAATCATGAAAAATCCTCCTCTTATAGAAAAAGCTCCTAGTCAGAACATCGAGAAAAAAAGCTGGTACAAGAAATTGCC
TTTTGAGGACGAACTAAAACCGGCTATAGAAAAAGGTAGGGTGCTCTTAATTGAGAACCTTGAACCATCATACACATCGC
TGGAGGTAGAGGATCTATGTAGGCAAGCTTTCAAAGAAGCAGTTGATGCTAAGATGATCCCTTCAAGTCTTGTGTCTAGC
CCACATAGTGGTATATGCAGGGCTCTTGTGATTTTTGGAACCACAAAGGCAGCTGATTCTGCCATGTCGCAGTTAACTGA
AAAGTGCCTGATGTTACCTGGCCAGAGACCTCTATTGGGTAGCAAAAAGGTCCCACTCGAAATTGGAAGATGTAGAAGCT
TTACTGGCCATTTTAGCATGGTGGATAGATCAATGATGACAACTCAGAAGGTAAGTTGTTGCATTAGTCATGTCAAAGAT
TTTTCTTGTTTCAACTCTCTCAAAATTCCCGAATACAAAACATTGTCTCACACAATATTGTTCTTCTAA