Details for Lyrate rockcress Locus 16043662

Position : sca3 ( 5`- 5220217 .. 5221853 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043662

Protein [Map View]
MDGRLSNKWRVTVNESKFVESALQSELRVDGRGLYDYRKLTIKFGKEYGSSEVQLGQTHVMAFVTAQLVQPYKDRPNEGS
FSIFTEFSPMADPSFEPVHPGESAVELGRIIDRALRESRVVDTESLCVFAGKLVWNLVDAANIAALAALLTFRRPDCTVG
GENSQEVIIHPPEEREPLPLIIHHLPIAFTFGFFNKGSILVMDPTVVEEAVMSGRMTVTVNANGDICAIQKPGEEGVNQS
VILHCLRLASSRAAATTKIIREAVEAYNRERSSQKVIRHHTLAKSEVLGPIEVV*

DNA
ATGGATGGGAGGTTGAGTAATAAGTGGAGGGTGACTGTGAATGAGAGTAAATTCGTGGAATCTGCGTTGCAATCTGAGCT
CAGAGTCGATGGTCGTGGCCTTTATGATTACCGCAAGCTTACTATTAAGTTTGGCAAGGAATATGGTAGCTCAGAAGTTC
AACTGGGTCAGACTCATGTAATGGCTTTTGTGACTGCTCAGCTAGTACAACCTTACAAAGACAGACCTAATGAAGGCTCC
TTCTCTATCTTCACGGAGTTTTCTCCAATGGCTGATCCATCATTTGAGCCTGTTCATCCTGGTGAATCTGCTGTTGAGCT
GGGCCGTATTATAGACCGTGCTCTAAGAGAAAGCCGTGTAGTAGATACAGAGTCGCTCTGTGTTTTTGCTGGAAAGCTGG
TCTGGAACTTGGTTGATGCTGCAAATATTGCTGCTTTAGCGGCACTCTTGACATTCAGGAGACCTGATTGCACTGTAGGA
GGGGAGAACAGTCAAGAAGTGATCATACACCCACCCGAAGAAAGGGAGCCACTTCCGTTGATAATACATCATCTCCCAAT
AGCCTTCACGTTTGGATTTTTTAATAAAGGCAGTATCTTGGTGATGGACCCAACAGTTGTTGAAGAAGCTGTTATGTCTG
GGAGAATGACTGTGACAGTCAATGCCAATGGCGATATATGCGCAATCCAGAAACCAGGAGAAGAAGGCGTGAACCAGAGT
GTAATCCTTCATTGCCTGCGTCTTGCTTCCTCAAGAGCTGCTGCAACAACTAAGATAATTAGAGAAGCAGTTGAAGCATA
CAACCGTGAGAGGAGCTCACAGAAGGTGATACGACATCATACTTTGGCTAAGTCTGAAGTTTTGGGACCTATTGAAGTTG
TGTAG