Details for Lyrate rockcress Locus 16043656

Position : sca3 ( 5`- 13014509 .. 13013473 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043656

Protein [Map View]
MTSLPIILASSPLRNLTKPSSTSQTLKPNPNSPKQPPIHLLTKTHLSVTISQLIITSPVLASESFDSISSDPSPGRIDLE
SILVTIDNFFNKYPFFVAGCTFIYLVVYPSVIFYLRKYKPISAMNAFRKLKMEADSQLLDIRDDKTLATLASPNLKFLGK
SSVQVPFSENDEDGFLMKVKGRFSDPENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIRGGARGKNGWLAIQEELLPPP
VHMYTAKNVKSSNNNEASIVGTEN*

DNA
ATGACGTCTCTTCCGATAATCCTCGCATCCTCTCCACTGCGAAACCTAACAAAACCTTCTTCAACTTCTCAAACCCTAAA
ACCCAATCCAAATTCACCAAAACAACCTCCAATACATCTCCTAACCAAAACCCATCTCTCTGTAACCATTTCCCAACTCA
TCATCACTTCCCCTGTTCTCGCATCTGAATCATTCGACTCAATTTCATCAGACCCATCTCCTGGAAGAATCGATTTGGAG
TCAATTTTAGTCACAATTGATAATTTCTTCAACAAGTATCCATTTTTCGTAGCGGGATGTACTTTTATCTATCTTGTGGT
TTATCCATCTGTGATTTTTTACTTGAGGAAGTATAAACCAATATCCGCCATGAATGCGTTTCGTAAGCTTAAGATGGAAG
CTGATTCTCAGCTTTTGGATATTAGAGATGATAAGACTTTGGCTACATTGGCGTCACCGAATCTTAAGTTTTTGGGTAAG
AGTTCTGTTCAAGTTCCGTTTAGTGAGAATGATGAAGATGGGTTCTTGATGAAAGTTAAAGGAAGGTTCTCTGATCCTGA
AAATACAGTTGTTTGTGTTCTTGATAATTTTGATGGTAATTCGTCGAAAGTGGCGGAATTGTTGATCAAGAATGGTTTCA
AAGAAGCTTATTATATTAGAGGTGGCGCGAGAGGGAAGAATGGTTGGTTGGCTATTCAAGAAGAGCTTTTGCCTCCACCG
GTGCATATGTATACTGCGAAAAACGTCAAATCTTCAAACAACAATGAGGCGTCAATTGTTGGAACTGAGAACTAG