Details for Lyrate rockcress Locus 16043647

Position : sca3 ( 5`- 3467591 .. 3466499 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043647

Protein [Map View]
MDDLSLEKIEISGPTLASLIQRASSSPSDVDGLIFGQIHRIVSSNLSDDSPADFASSSSSDQIVATVTSFICSGKTVSFY
DPLGRVDSRRIDSLRIDSPDRLIGWFSARRKTVNRPSMRELAVASSLSSQFHLPIEDSQNPNSTNMASSVFFLLTTPSTN
QCIHTHEYRAYQFRPSKQRLEPRSVAIVNIGPAFRGHYGSFSPKSGFPPLICELSSSAMSVDCDESSLSAKKQSAKDQKE
IDALAEGLQVGDLKRLVGAEAANYTGGIEEMYERMLAKIESLASDVEKSSARVFEQVKHNRKLRNRVARIGR*

DNA
ATGGACGACCTCTCTCTGGAGAAAATCGAGATTTCGGGTCCAACATTGGCGTCACTGATTCAACGAGCTTCCTCTTCTCC
CAGTGACGTCGATGGCTTGATCTTCGGCCAAATCCACCGCATCGTCTCTTCCAATCTTTCCGACGATTCTCCGGCGGATT
TCGCCTCCAGTTCCTCATCTGATCAAATTGTCGCCACCGTTACAAGCTTTATCTGCTCTGGTAAGACTGTCTCCTTCTAT
GATCCGCTTGGCCGAGTTGACTCGCGTCGAATCGATTCCCTCCGAATCGACTCACCGGACCGCCTAATTGGCTGGTTCTC
CGCCCGCAGGAAAACCGTTAACCGTCCATCAATGAGAGAGTTAGCCGTCGCGTCGTCTCTCTCGTCTCAATTTCACTTAC
CGATCGAGGATTCGCAAAACCCTAATTCGACGAACATGGCTTCCTCCGTGTTCTTTCTTCTTACTACGCCGTCGACGAAT
CAGTGCATCCACACGCACGAGTACCGTGCGTACCAGTTCCGACCCTCGAAACAACGGCTCGAACCGAGATCCGTTGCTAT
AGTCAACATTGGACCAGCGTTTCGAGGCCATTACGGTTCGTTTAGTCCAAAATCGGGATTTCCACCGTTGATTTGCGAGT
TGAGTAGCTCAGCCATGAGCGTGGATTGCGATGAGAGTTCCTTAAGTGCCAAGAAACAATCAGCAAAAGATCAGAAGGAG
ATTGATGCGCTAGCAGAGGGGTTACAAGTTGGAGACTTGAAACGTTTGGTTGGAGCTGAAGCTGCGAATTACACTGGCGG
GATTGAAGAAATGTATGAGAGAATGTTGGCGAAGATCGAAAGCTTGGCTTCTGATGTTGAGAAGAGCTCAGCTAGGGTAT
TTGAACAGGTAAAGCATAATAGGAAGTTGAGAAACCGGGTGGCCAGAATCGGGCGATGA