Details for Lyrate rockcress Locus 16043625

Position : sca3 ( 5`- 8878576 .. 8878226 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043625

Protein [Map View]
MGNCLRHESEMHWAGEDWDEFITEDEEDHHYSSKTTRDGKTVVVTRDSKSSVPSHEIKIRLTKKQLHDLLSKVNVHDLTF
HQQAAFSCPSLNNRGYEEANHQRLWRPVLQSIPEVN*

DNA
ATGGGGAATTGTTTAAGGCATGAATCAGAAATGCATTGGGCTGGTGAAGATTGGGATGAATTCATCACAGAAGATGAGGA
AGATCATCATTATAGCTCTAAAACCACCAGAGATGGGAAAACAGTAGTTGTAACACGTGACAGTAAATCCTCTGTTCCAT
CTCATGAGATCAAGATCAGGCTCACGAAGAAACAACTCCATGATTTACTGAGTAAAGTCAACGTCCATGACTTGACCTTT
CATCAACAGGCTGCTTTCTCATGTCCAAGCCTGAACAATCGTGGGTACGAAGAAGCCAATCATCAACGGTTATGGAGACC
GGTTCTGCAGAGCATACCAGAGGTTAATTGA