Details for Lyrate rockcress Locus 16043616

Position : sca3 ( 5`- 7593097 .. 7589115 -3` )
Annotation : [B2G] dihydroxyacetone kinase family protein
External links : CoGe
PGDD synteny : 16043616

Protein [Map View]
MVFAAKKFINNPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAAKYDKVAVISGGGSGHEPAHAGYVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGSEGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLA
GTVLVHKVAGAAAAAGLSLEKVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGAEKMELGLGIHGEPGAAVVDVQPVD
LVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAVDRVYTGFFMTSLDMAGFSIS
IMKADQSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPVPPSRSIKSTESQSRPLELSKEGQILEAAIQAAATVIISLKDS
LNEWDGKVGDGDCGSTMYRGATAILEDLKNYYPLNDAAETVNEIGSSIKRAMGGTSGIIYHLLCKAAYAELKANAQSEVT
PKNWSEALKSAIASVSKYGGASAGYRTMLDALIPASQVLEEKLSGGEDPISAFILSAEAATAGAESTIQMQAQAGRSSYV
SAEILATVPDPGAMAAAGWYSGAARAVKELCQGSS*

DNA
ATGGTTTTCGCGGCCAAGAAATTCATCAACAACCCCAACGATGTTGTAACTGAGTTCATAGAGGGTCTGGTCGAAACTTA
TCCTGGACTCCAGTATTTGGATGGCTTTCCTGAGGTTAAAGTGGTGCTACGAGCTGATGTTTCGGCTGCAAAATATGACA
AGGTTGCCGTTATCTCAGGTGGAGGCAGTGGGCATGAGCCTGCACATGCTGGATACGTTGGAGAAGGAATGCTAACAGCT
GCTATCTGTGGAGATGTCTTTGCCTCCCCACCAGTTGATTCTATCCTTGCTGGAATCCGAGCTGTAACTGGTAGTGAGGG
ATGTCTATTGATTGTCAAGAATTATACTGGTGATCGCTTGAACTTTGGTTTGGCTGCTGAACAAGCAAAATCTGAAGGTT
ACAAAGTTGAGACTGTAATTGTTGGAGAGGATTGCGCTTTACCCCCGCCACGTGGTATCGCTGGACGCAGAGGGTTAGCA
GGAACAGTTCTCGTCCATAAGGTTGCAGGTGCAGCAGCAGCTGCTGGTCTTTCTCTAGAAAAAGTTGCGGCTGAGGCAAA
ATGTGCGTCAGAGATGGTTGGTACCATGGGTGTTGCATTATCCGTCTGTACACTTCCTGGACAGGTTACATCAGATCGTC
TAGGCGCAGAGAAGATGGAACTCGGGCTTGGAATTCATGGAGAACCTGGTGCTGCTGTGGTTGACGTTCAACCTGTGGAT
TTGGTGGTTTCCCATGTTCTTCAGCAGATACTTAGTCCTGAGACCAATTATGTTCCAATTACACGTGGTAACAGAGTGGT
TCTCATGGTTAATGGTTTGGGAGGCACCCCTTTAATGGAACTTATGATTGCTGCTGGAAAAGCAGTCCCTAAACTGCAGT
TGGAATTTGGACTTGCCGTTGATAGGGTGTATACAGGCTTTTTTATGACTTCTCTTGATATGGCAGGATTCTCGATTTCA
ATCATGAAGGCTGACCAGTCGATTTTAGACCGATTGGATGCTCCAACCAAGGCTCCAAATTGGCCTGTTGGCACTGATGG
CAACCGGCCACCAGCGAAGATTCCTGTTCCTGTTCCTCCTTCTCGATCAATAAAAAGCACCGAGTCTCAAAGTCGACCTC
TAGAGCTGAGTAAAGAGGGTCAGATTCTTGAGGCAGCTATTCAAGCAGCAGCAACTGTGATCATCAGCCTTAAGGATAGT
TTGAACGAATGGGATGGAAAAGTGGGCGACGGTGATTGTGGGTCAACAATGTACAGAGGTGCAACAGCTATTCTGGAGGA
CTTGAAAAACTATTATCCACTCAATGATGCTGCGGAAACAGTGAATGAGATTGGTTCATCAATCAAAAGAGCCATGGGGG
GCACAAGCGGAATAATTTACCATCTCCTCTGCAAGGCAGCATACGCGGAGTTAAAAGCAAACGCTCAGTCAGAAGTCACT
CCCAAAAACTGGTCTGAAGCACTCAAGTCAGCAATCGCTTCAGTCAGCAAATATGGTGGAGCAAGTGCAGGCTACAGAAC
GATGCTAGATGCTCTCATCCCAGCTTCACAAGTTCTTGAGGAGAAGTTGAGCGGTGGAGAGGATCCGATATCTGCTTTCA
TTCTGTCAGCCGAAGCAGCAACTGCAGGAGCGGAATCAACAATACAGATGCAAGCACAGGCTGGGAGATCAAGCTATGTG
TCTGCAGAGATTCTTGCAACGGTTCCAGATCCAGGTGCAATGGCAGCAGCAGGATGGTACAGCGGCGCAGCAAGAGCCGT
GAAGGAGCTGTGTCAGGGCTCATCATGA