Details for Lyrate rockcress Locus 16043589

Position : sca3 ( 5`- 3749698 .. 3751618 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043589

Protein [Map View]
MASSSSRSLVSSYTFDDKDLEDADLWAVIDSAAAAATIAGKSPKPLAIRYPNYNSPPTPVSYPSPQSKVLQIQNRDPNLG
RRLNEESTRPNKMARSRVLSEVKSESPMALVTTSHRNLTPNIINSTKFSSPESYLSPGIRQSTPFAEVSPSASCVKNDPV
NEMRHSLSGSFPSATLFKEYQNTAMAILEKSDYTMISGKAYIKKSGWRKISFYFNVSYEIRDKTIEFDENRNVQRAEFTV
RAIMHGGRFADGWGSCERREKKFLKPNHDIPSTAETRAKNRACQDLLGIGEYREPR*

DNA
ATGGCGTCGTCATCGTCACGATCGCTGGTTTCTTCCTATACCTTTGATGATAAAGACCTAGAAGACGCTGATTTATGGGC
GGTCATTGATTCCGCCGCTGCTGCAGCTACTATCGCCGGCAAATCTCCGAAACCCTTAGCTATTAGGTATCCAAATTACA
ATTCTCCTCCTACGCCTGTTTCGTATCCTTCTCCACAGTCGAAGGTTCTTCAGATCCAGAATCGTGACCCTAATCTTGGC
CGGCGGTTGAATGAAGAGTCTACGCGTCCGAACAAAATGGCCAGATCTCGCGTCTTGTCTGAGGTGAAGAGTGAGAGTCC
GATGGCTCTTGTTACGACGTCGCACCGAAATTTAACCCCGAATATCATCAATTCGACTAAGTTTTCTTCTCCGGAGAGTT
ACTTGTCGCCTGGAATTCGGCAGTCTACTCCCTTTGCGGAGGTTTCTCCGTCAGCGAGCTGTGTTAAGAACGATCCGGTT
AATGAGATGCGACATAGCTTGTCTGGGAGCTTTCCTTCTGCTACTCTGTTCAAGGAGTACCAGAATACAGCAATGGCGAT
TCTAGAAAAATCTGACTACACGATGATCTCAGGGAAGGCATACATTAAAAAGTCAGGTTGGAGGAAAATATCGTTTTACT
TCAATGTGTCTTATGAAATAAGAGACAAGACTATTGAATTCGACGAAAACAGAAATGTCCAGCGTGCTGAGTTCACCGTT
CGAGCCATTATGCATGGAGGAAGATTCGCTGACGGATGGGGTTCTTGTGAGCGACGTGAGAAGAAATTTCTCAAACCAAA
TCACGATATTCCCAGCACAGCAGAGACCAGAGCCAAAAACAGGGCTTGTCAGGATCTTCTTGGAATCGGTGAATATCGAG
AACCACGATGA