Details for Lyrate rockcress Locus 16043584

Position : sca3 ( 5`- 7838879 .. 7841704 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043584

Protein [Map View]
MELPPPPERSKRLHNFTLPYLRWGQQRFLRCVKLPHHNRSPSSSSPSPDHRSHNGGLVGELRVDLVYDANKPKLSVLGNG
GDNNGDVVAAAARPWNLRTRRAACNEPGDESTRIIESSSSLRRHEIGVKRGGSEDGGDGDSQHKNEKVKFSVSLLREEIE
QDFSALIGKRPPRRPKKRPRLVQKQMNSCKKKVSEQSFIFPPNRAKRTIMICTESNHQRISFAGDLGQSDKGPPMEHQPS
GPVRRDTALLDSSNSDFEFHISRNFDPEDSSPADEIFADGMILPVLPFQVTAGSTMPKRLYKYELPPIVSAPSLSSYLPP
LPLPLPEHSIKYSVKETRGSVNGRGSVANSDSEAEKSSKSFWSFKRSSSLNCDIKKSLICSFPRLTRSNSTGSVMNSKRE
MLRDINKHSSQRHGVPRPGVNQSSHMRPPSSLCCSSYQFRPQKHAGKNGGGRGGSFWIAPVIGGPSPFGLGSILRLTKEK
KKK*

DNA
ATGGAGCTTCCTCCTCCACCGGAAAGATCCAAACGCCTCCATAACTTCACCTTACCTTATCTCCGATGGGGTCAGCAAAG
ATTCCTCCGCTGCGTCAAGCTTCCTCACCACAACCGATCTCCTTCTTCTTCTTCTCCTTCTCCCGATCATAGATCTCACA
ACGGTGGACTTGTTGGAGAGCTCAGGGTCGATCTCGTCTACGATGCCAACAAACCTAAGCTCTCCGTTTTGGGAAATGGA
GGTGACAACAACGGCGATGTTGTTGCTGCAGCTGCTCGGCCGTGGAATTTGAGGACCAGAAGAGCTGCTTGTAACGAACC
TGGTGATGAATCCACCAGGATCATCGAGTCTTCTTCTTCTCTACGGAGACATGAAATTGGCGTTAAGAGAGGTGGTAGCG
AAGATGGTGGTGATGGTGATTCGCAGCACAAGAATGAGAAAGTGAAATTCTCTGTTTCTTTGTTGAGAGAAGAAATCGAA
CAAGATTTCTCAGCCCTAATTGGAAAAAGACCTCCTAGAAGACCAAAGAAGAGACCGAGATTGGTTCAGAAGCAAATGAA
TTCCTGCAAAAAGAAAGTCTCTGAGCAGAGTTTCATCTTTCCGCCAAACAGAGCAAAAAGGACCATCATGATCTGCACGG
AGTCAAACCACCAGCGAATTTCGTTTGCTGGTGATCTCGGCCAGTCCGATAAAGGACCTCCTATGGAACATCAACCATCA
GGCCCGGTTCGAAGAGACACAGCTCTTTTAGATTCATCAAACTCAGATTTCGAGTTCCACATCTCAAGAAACTTTGATCC
TGAAGATTCCTCACCAGCCGACGAGATCTTTGCAGACGGCATGATCCTCCCGGTCCTTCCTTTCCAAGTAACAGCTGGAT
CCACCATGCCAAAACGTCTCTACAAATATGAGCTCCCTCCTATTGTCTCTGCTCCATCCTTATCCTCCTATCTTCCTCCT
CTGCCTTTACCATTGCCTGAACACTCGATAAAATACAGCGTGAAAGAAACTCGTGGAAGCGTAAATGGTCGAGGGAGCGT
TGCCAATTCGGACTCAGAGGCAGAGAAATCATCAAAGTCGTTTTGGAGCTTCAAAAGAAGCTCAAGCCTTAACTGCGATA
TAAAGAAGAGTCTGATCTGTTCGTTTCCTCGTTTAACGAGAAGCAATTCCACAGGATCAGTGATGAATTCGAAGAGGGAA
ATGCTTAGGGACATTAACAAGCATAGCTCGCAGAGACATGGAGTCCCACGTCCAGGGGTGAATCAATCATCTCATATGCG
TCCTCCTTCATCTCTCTGCTGCAGCTCGTATCAGTTCAGGCCACAAAAACACGCCGGAAAGAATGGTGGTGGAAGAGGAG
GAAGTTTTTGGATTGCTCCGGTGATCGGTGGTCCATCTCCGTTTGGGTTAGGATCCATCTTACGACTTACGAAAGAGAAG
AAAAAGAAGTAA