Details for Lyrate rockcress Locus 16043555

Position : sca3 ( 5`- 791083 .. 795410 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477535 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043555

Protein [Map View]
MGRKSRPKMQSGTCNVCSAPCSSCMHRNAEFTSSKSDESPDENSHGVLASQCSFNGDNLLRSSGVNAPGSSHNTASEASH
LVNSNRDTSSENAESMEIIRSSDISHGPILDRSRKEQDSIMVDSCSDHQARSTLGQGKVKEKSGANNIEDKKNTLTGSSK
HSGRRVGKSGENVLLNNADESNTSAMSESESETDPEMLDVKVCDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPK
GYWLCEECKFAEEAEKQKLETKGKRESEVNRNTQSSSKRHIDKFETAPDSKRLAVEAPTGSPKRSVLPRVSALSRETSFK
GLEKPARKLAHHSSFNSYSSDDTESTRSTDSQLRSPKGSFYKSNSFNSSSSRPKVRPVDDVMLPRQKTGKGNSSFDVKEG
FSKNVGKSMSSRCIDVGSSSCNGSEVKGSKQLKDRSTVANPSVSISRGNSSIPYAKSPRDLKDLQSDGKQVGDSSKNEKC
SSSEQISSETKCKDELAHVDGLPRSREFREAGEKSKDAVGNHQKQNISEDINKGNRLRAAVDAALRKKPSFSKNRGLEQS
DLPSVSNVDSGCNKALKSLPSKVPVIRDWPVGFQGLPGGHPNLRTDKQTNAVNGNQSTLAGTDAMAAFQSVELEVNFPSV
KPVMRDLPVAAPNVLSTTSAIPEHEYIWQGDLEVQKSRNLSAMHSGIQAYLSTSASPKVVEVVKQFPEKVTLNEVPRLSS
WPAQFQDTGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGSLEGVELLIFASNQLPQDCQRWNMLFFLWGVFR
GKKESCSNPPKNTRLPASCVLPNMKKAFSTRETFHHENPSNRESLTDRTSNRMQSCMKEEKAKEGKACGAIEKENAFSVS
YGERGVAEEIEEGEIGVSPHLKDEKTGPGTVKSSDMNQKVSVDDLNKEGLCEGPANKKLKTVTGVETGCSIVRRDTSVHK
FASKRTSDI*

DNA
ATGGGTCGCAAAAGTCGTCCTAAAATGCAGTCTGGAACTTGTAATGTCTGCTCTGCTCCTTGTTCATCTTGCATGCATCG
TAATGCGGAATTTACCAGTTCAAAGTCAGACGAGTCACCAGATGAGAACTCCCATGGTGTACTGGCGAGCCAGTGTTCTT
TCAACGGGGACAATCTTTTGCGTTCTTCTGGGGTTAATGCTCCCGGCAGTTCACATAACACTGCTAGTGAAGCGAGCCAT
CTGGTTAATTCCAATCGTGATACTTCATCTGAGAATGCTGAGAGTATGGAAATTATAAGATCTTCTGATATTTCCCATGG
CCCAATATTAGATAGGTCTCGCAAAGAGCAAGATTCCATCATGGTAGATTCATGTAGTGACCATCAGGCCAGAAGCACTC
TAGGGCAGGGAAAAGTCAAGGAAAAGTCAGGAGCAAATAATATTGAAGACAAGAAAAATACTTTAACTGGAAGTTCTAAG
CATTCAGGACGAAGGGTTGGGAAGTCAGGAGAAAATGTTCTCTTAAATAACGCAGATGAATCAAACACATCAGCCATGTC
TGAGAGTGAGAGTGAAACTGATCCTGAAATGCTTGATGTAAAAGTATGTGATACTTGTGGAGATGCGGGTCGTGAGGATT
TACTTGCTATCTGTAGCAGATGCAGTGATGGTGCAGAACACACCTATTGCATGCGAGTAATGCTTAAAAAAGTTCCTAAG
GGTTATTGGCTTTGCGAAGAATGCAAGTTTGCTGAGGAAGCAGAAAAGCAGAAGCTAGAAACCAAGGGAAAAAGAGAAAG
TGAGGTAAACAGGAATACACAGAGCTCCAGCAAAAGGCACATAGATAAATTTGAGACAGCTCCAGATTCTAAAAGATTGG
CAGTTGAGGCTCCAACAGGGTCACCCAAGAGATCTGTTCTCCCCAGAGTGTCCGCTTTATCCCGAGAAACATCATTTAAG
GGCTTAGAGAAGCCTGCGAGAAAGCTAGCTCATCACTCATCCTTCAATAGCTACTCCAGTGATGACACAGAAAGCACACG
ATCTACTGACTCGCAGCTCCGGTCCCCTAAAGGTTCCTTTTACAAGTCCAATTCGTTTAATTCTTCGAGCTCTAGACCAA
AAGTGAGACCAGTGGATGATGTTATGCTTCCACGACAGAAGACTGGGAAAGGAAATTCTTCCTTTGATGTAAAGGAAGGA
TTTTCTAAAAATGTAGGGAAATCAATGTCAAGTAGATGTATAGACGTAGGGAGCTCTAGTTGTAATGGCTCAGAAGTAAA
AGGTTCAAAGCAACTGAAAGATCGGAGCACAGTAGCTAACCCTTCAGTATCCATTTCACGTGGCAATTCATCCATTCCTT
ATGCAAAAAGTCCCCGTGATTTGAAGGATTTGCAGTCTGATGGTAAACAAGTGGGGGATTCATCTAAAAATGAAAAGTGT
AGTTCAAGCGAGCAAATATCAAGTGAAACGAAATGTAAAGATGAACTGGCACATGTAGATGGTTTACCTCGGTCGAGGGA
ATTCAGAGAGGCGGGGGAGAAAAGCAAAGATGCTGTTGGTAATCACCAAAAGCAAAATATTAGCGAAGATATTAATAAGG
GCAATAGGTTGCGAGCAGCGGTTGATGCTGCACTGCGTAAAAAACCCAGCTTTAGCAAAAACAGAGGGTTGGAGCAATCT
GATTTGCCTTCAGTGTCTAATGTGGATTCCGGTTGTAATAAGGCTTTAAAAAGTTTACCCTCAAAGGTGCCGGTCATAAG
AGATTGGCCTGTGGGATTCCAAGGATTGCCTGGAGGGCATCCAAATTTACGGACAGACAAGCAGACAAATGCAGTAAATG
GAAACCAGTCTACACTCGCTGGTACTGATGCAATGGCTGCTTTCCAATCTGTTGAACTTGAAGTTAATTTTCCTTCTGTA
AAACCGGTCATGAGAGATTTGCCTGTGGCTGCCCCAAATGTTCTGTCGACAACCTCAGCCATCCCAGAGCATGAGTATAT
TTGGCAAGGGGACTTGGAGGTGCAGAAAAGCAGAAATTTATCAGCAATGCATAGTGGAATACAAGCGTATCTTTCAACCT
CAGCATCACCTAAGGTGGTTGAAGTGGTGAAACAATTTCCTGAAAAAGTCACCTTGAATGAAGTACCCAGGCTTAGTTCA
TGGCCTGCACAGTTTCAAGATACAGGTGCTAAGGAACAGCATGTGGCTCTTTTCTTCTTTGCCAAGGACATCGAGAGTTA
TGAGAAAAATTATAAGCCTCTGGTAGATAACATGATTCAGAAAGATTTAGCCCTAAAGGGAAGCCTCGAGGGTGTTGAGC
TTTTGATTTTTGCGTCCAACCAGCTTCCTCAGGATTGCCAGCGCTGGAACATGTTATTTTTCCTTTGGGGTGTATTCCGA
GGAAAAAAAGAGAGTTGCTCTAATCCACCTAAGAACACACGTCTTCCGGCGTCTTGTGTTTTGCCAAATATGAAGAAAGC
TTTTTCTACTCGTGAGACCTTTCACCATGAGAATCCAAGCAACAGAGAGTCTTTGACTGATCGCACGTCGAACAGAATGC
AATCGTGCATGAAGGAGGAGAAAGCTAAAGAGGGTAAAGCGTGCGGTGCCATTGAGAAGGAGAATGCATTCTCTGTTTCA
TATGGAGAACGTGGAGTGGCTGAAGAAATCGAGGAAGGAGAGATAGGTGTTAGCCCACACTTGAAGGATGAGAAGACGGG
GCCTGGGACAGTGAAATCCTCCGACATGAACCAGAAAGTGAGCGTGGATGATCTGAATAAAGAAGGGTTGTGTGAAGGTC
CAGCGAATAAAAAGCTGAAGACAGTTACAGGAGTAGAAACTGGATGTAGCATTGTCAGGAGGGATACCTCTGTTCATAAA
TTTGCTTCAAAGAGGACTTCTGACATCTGA