Details for Lyrate rockcress Locus 16043546

Position : sca3 ( 5`- 22296991 .. 22298007 -3` )
Annotation : [B2G] short-chain dehydrogenase reductase family protein
External links : CoGe
PGDD synteny : 16043546

Protein [Map View]
DKSLYLNYVMGFSFSTEEHAKRNNMSNHQTPWCELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAEARRVDRLKSLCSE
INSFEYSAGLQAAALELDVSSDAPTIQKAIDVLINNAGFRGNWDKVIKTNLTGTWLVSKYVCILMRDAKRGGSVISILSV
SGLHRGQVPGGVAYACSKGGVDTMTRMMAVGLGVYKIRVNSIAPGLLKSEITQGLMQKEWLKNVNERIVPLKVQQAVDPG
LTSLVRYLIHDSSQYISGNTYIVDSGSSLPGVPIFSSL*

DNA
GACAAGTCTTTGTATTTAAACTATGTTATGGGCTTCTCCTTCTCCACCGAAGAACACGCAAAGAGAAACAATATGAGTAA
TCATCAAACTCCATGGTGTGAACTTAAAGACAAAGTGGTTCTTGTGACAGGAGCTTCCTCTGGTATAGGAAGAGAGGTAT
GTCTTGATCTAGCCAAAGCTGGCTGTAAGATTATCGCAGAAGCTCGTCGTGTCGATCGTCTCAAATCTCTCTGCTCTGAA
ATAAATAGCTTCGAATATTCAGCCGGACTTCAAGCTGCAGCTCTTGAGCTAGACGTTTCATCAGACGCACCCACCATTCA
AAAAGCGATCGATGTGTTGATCAACAATGCGGGATTTAGAGGCAATTGGGACAAAGTCATCAAGACCAACTTAACGGGAA
CTTGGTTAGTCTCCAAATATGTATGCATTTTAATGCGCGACGCTAAACGTGGTGGCTCGGTGATAAGCATATTATCAGTC
TCTGGCCTCCACCGCGGTCAGGTGCCTGGTGGAGTCGCGTATGCTTGTTCTAAAGGCGGTGTTGACACCATGACAAGGAT
GATGGCTGTTGGGTTAGGTGTTTACAAGATCAGAGTGAATTCGATCGCACCGGGGCTTTTAAAGTCAGAGATCACACAAG
GTCTTATGCAAAAAGAGTGGCTCAAGAACGTTAATGAACGGATAGTCCCATTAAAGGTACAACAGGCAGTGGATCCGGGG
CTTACATCTCTCGTTCGCTACCTCATTCACGACTCGTCTCAATATATCTCCGGGAATACATACATTGTCGATTCCGGATC
TTCATTACCCGGCGTGCCTATTTTTTCATCTCTCTAA