Details for Lyrate rockcress Locus 16043523

Position : sca3 ( 5`- 7770972 .. 7772808 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341951 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043523

Protein [Map View]
MTEKDLLFDTILARSFSRTGKKRLGYGAFIASLLFVFTLCTVSKPYLSPLPIVEMQLSVDAGLRMLKITEPQALRSSNNE
TSADSEKLIIQTNQDNVTSSAVITQSLISSEDHKLSVCNDTSLPKNFLDSFNCTTNTTIPKEEVISDENKLEKTMKPICT
KLARTEFCELSGDVRIHGKSATVLAAITFAFSGNSTWHMRPYARKGDLVAMNRVRKWTVKLEQNADQLENANFSRCVRNH
SVPAMIFSLGGYTMNNFHDFTDVVIPLYTTARRFNGEVQFLVTNRNPWWINKFKELVKKLSNYEVIYIDEEDETHCFSSV
TVGLIRHREYFTELTIDPSNSEYSMSDFRSFLRDTYSLRNAAVITSQIRRRRPRILILSRSRSRAFENTGEIARAARQIG
FEVVVAEANTGVANFAQTVNSCDVMLGVHGAGLTNMVFLPDNAVVIQILPIGGFEWLAKTDFERPSEGMNLRYLEYKIAA
EESSLVKKYGRDHEVVRDPSAVAKHGWDMFKSVYLVHQNVSIDINRFKPALVKALELL*

DNA
ATGACAGAAAAGGATCTTCTTTTCGACACGATACTTGCTCGTAGTTTTAGCAGAACTGGGAAGAAGAGACTTGGATATGG
AGCTTTCATTGCCTCTCTTCTCTTCGTCTTCACTCTTTGCACTGTCTCTAAACCTTACCTCAGCCCTCTACCAATCGTGG
AGATGCAATTATCAGTGGACGCTGGTCTCAGAATGCTGAAAATAACAGAACCGCAAGCATTAAGGAGCAGCAACAATGAA
ACATCCGCAGATTCAGAGAAACTCATTATCCAAACGAATCAAGATAATGTTACATCCAGTGCAGTGATTACTCAGAGCCT
AATCAGTTCTGAAGATCACAAGCTTAGTGTATGCAACGACACAAGCTTGCCAAAGAATTTTCTCGATTCGTTTAATTGTA
CTACCAACACTACAATCCCCAAGGAAGAAGTTATTTCAGATGAAAATAAATTGGAGAAAACTATGAAACCTATATGCACC
AAGCTAGCAAGAACAGAGTTCTGTGAATTAAGCGGCGACGTAAGAATCCACGGTAAGTCCGCGACTGTTTTAGCTGCGAT
CACGTTTGCGTTTTCAGGGAATTCCACGTGGCATATGAGACCTTACGCGCGAAAAGGTGACCTGGTGGCGATGAATCGCG
TGAGAAAATGGACCGTGAAATTGGAACAAAACGCTGACCAATTAGAAAACGCTAATTTCTCGCGTTGCGTTAGGAATCAC
AGCGTTCCGGCGATGATTTTCTCTCTCGGAGGCTACACGATGAACAATTTCCACGATTTCACCGATGTCGTGATTCCTCT
GTACACGACGGCGCGTCGATTCAACGGCGAAGTTCAGTTTCTCGTGACGAACAGGAATCCATGGTGGATCAACAAATTTA
AGGAATTAGTGAAGAAACTATCGAATTACGAAGTGATTTACATCGACGAAGAAGACGAAACGCATTGTTTCAGCAGCGTC
ACCGTCGGTCTCATTCGCCACCGTGAGTATTTCACTGAGTTGACTATCGATCCTTCAAATTCGGAATATTCAATGTCCGA
TTTCCGGAGTTTTCTAAGAGACACCTACTCATTGAGAAACGCCGCGGTGATTACGAGCCAGATCCGGCGGCGGAGGCCAC
GGATCCTGATTTTGTCGAGGAGCAGATCGCGAGCGTTCGAAAACACCGGCGAAATCGCGAGAGCGGCGAGACAGATCGGG
TTCGAAGTCGTGGTGGCGGAAGCGAACACCGGAGTCGCGAATTTTGCACAAACCGTGAATTCCTGCGACGTGATGCTCGG
CGTTCACGGCGCGGGGCTGACGAACATGGTGTTTTTGCCAGACAACGCGGTCGTGATTCAGATTCTTCCGATCGGTGGAT
TCGAGTGGCTTGCGAAGACGGATTTCGAGAGACCTTCGGAGGGAATGAATCTGAGGTATTTGGAGTATAAGATCGCGGCG
GAGGAGAGTTCGCTGGTGAAGAAGTACGGACGCGACCACGAGGTCGTGAGAGATCCATCGGCGGTTGCCAAACACGGGTG
GGATATGTTCAAGTCGGTTTATTTGGTACATCAGAACGTTAGTATTGATATAAACCGGTTCAAACCGGCTCTTGTCAAAG
CTCTTGAGTTACTGTAG