Details for Lyrate rockcress Locus 16043506

Position : sca3 ( 5`- 1697142 .. 1696273 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043506

Protein [Map View]
MRDFPSCSGENGVQIADSSSSSSAGRNAQNLVICIYRCRIRGRTCMITVTWTKNLMGQCVTVGVDDSCNRSLCKVEIKPW
LFTKRKGSKSLEAYACSIDVFWDLSSAKFGSSPEPLGGFYVGIVVDKEMVLLLGDMKKEAFKKTNAAPSSSLGALFIAKK
EHVFGKRTFATKAQFSGDGKTHDLVIECDTSISDPCLIVRVDGKTLMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFF
GMPSSPGNAVFMFRTCQSVEKTWSFTQVPTSSKSQSFGFSLILYAWKNE*

DNA
ATGAGAGATTTTCCTTCTTGCTCCGGTGAAAATGGCGTCCAGATTGCGGATTCTTCGTCTTCCTCGAGCGCTGGAAGAAA
TGCTCAGAATTTGGTCATTTGTATCTACCGATGCCGCATCCGAGGTAGGACTTGTATGATCACAGTCACATGGACTAAGA
ATCTTATGGGTCAGTGTGTTACCGTGGGAGTTGATGATTCTTGCAACCGAAGTCTGTGTAAAGTTGAGATTAAGCCGTGG
CTCTTCACTAAACGAAAAGGGTCCAAAAGTCTAGAGGCGTATGCCTGTAGTATCGATGTTTTCTGGGATCTCTCGTCTGC
TAAATTCGGATCCAGCCCTGAACCTTTAGGAGGGTTCTATGTTGGAATTGTTGTGGACAAAGAAATGGTTCTTCTTCTTG
GTGATATGAAGAAAGAGGCTTTTAAAAAGACGAATGCCGCACCTTCTTCATCTCTAGGTGCTCTGTTCATTGCTAAGAAA
GAGCATGTCTTTGGCAAGAGAACGTTTGCAACTAAAGCTCAGTTTTCAGGTGATGGCAAAACTCATGATCTTGTGATCGA
ATGTGACACCAGTATCAGTGATCCTTGTCTCATTGTTCGTGTTGATGGAAAGACCTTGATGCAAGTGCAGCGGCTTCATT
GGAAGTTCCGTGGCAACGATACCATAATTGTCAATAGGATCTCTGTGGAAGTCCTCTGGGATGTTCACAGTTGGTTCTTT
GGGATGCCATCATCACCAGGAAATGCCGTGTTTATGTTCAGGACTTGTCAATCTGTTGAAAAGACCTGGTCTTTCACGCA
GGTCCCCACGAGCTCGAAATCTCAAAGTTTTGGGTTTTCATTGATTCTGTACGCTTGGAAGAACGAGTAG