Details for Lyrate rockcress Locus 16043338

Position : sca3 ( 5`- 7512811 .. 7514070 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898103 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043338

Protein [Map View]
MENFGEGRRSGGGGMLPLLALSAVAEYYRLPWKPPVTASLLAANTLLYLRPAFIDPVIPHISEVWFNPHLIFKHKDLKRL
FLSAFYHVNEPHLVYNMMSLLWKGIKLETSMGSSEFASMVFTLIGMSQGVTLLLAKSLLVLFDYDRAYYNEYAVGFSGVL
FALKVVLNSQAEDYSSVYGILVPTKYAAWAELILVQMFVPNASFLGHLGGILAGIIYMKLKGSYSGSDPVTMAVRGVTRL
VTWPLRFLNGMVRSRRRRITGRGRVGRGQTGIAGPGIWRCQSCTYDNSGWLSACEMCGSGRARGDGWSLNQGPALSSSND
LPLDELRRRRVERFS*

DNA
ATGGAGAATTTTGGTGAAGGGAGAAGAAGTGGAGGCGGAGGGATGTTGCCGTTGCTGGCTCTAAGCGCCGTCGCGGAGTA
CTATAGATTGCCGTGGAAACCGCCGGTGACGGCGAGTCTTCTGGCCGCGAATACTCTCCTCTATCTCAGGCCGGCGTTTA
TCGATCCCGTTATTCCTCACATCAGTGAGGTCTGGTTCAATCCTCACCTCATCTTCAAGCACAAAGACTTGAAACGTTTG
TTTTTATCAGCGTTCTACCATGTAAACGAGCCTCACTTAGTCTACAACATGATGTCCCTTCTCTGGAAAGGTATCAAGCT
CGAGACATCTATGGGAAGCAGTGAGTTTGCTTCAATGGTCTTTACTCTTATTGGTATGTCTCAAGGAGTCACATTGCTGT
TAGCCAAATCGCTTCTTGTCTTGTTCGACTATGACAGAGCTTATTATAACGAGTACGCCGTTGGGTTCTCGGGTGTTCTC
TTTGCTTTGAAAGTTGTTCTTAATTCTCAGGCTGAGGATTACTCAAGCGTGTATGGTATCCTGGTTCCAACAAAGTATGC
TGCTTGGGCAGAACTGATCTTAGTGCAGATGTTTGTACCGAATGCTTCGTTTCTTGGGCATTTGGGTGGAATCCTTGCTG
GTATTATCTATATGAAGCTGAAAGGTTCTTACTCAGGCTCAGATCCAGTCACCATGGCGGTTAGAGGTGTAACTCGATTG
GTGACGTGGCCCTTGAGGTTTCTGAACGGTATGGTTAGGTCTCGGAGAAGGAGGATTACAGGGAGAGGAAGAGTGGGAAG
AGGCCAGACTGGGATAGCAGGACCTGGTATCTGGAGATGCCAGTCGTGTACATATGACAATTCTGGTTGGTTAAGTGCTT
GCGAGATGTGTGGCTCGGGACGGGCTAGAGGAGACGGATGGTCACTGAATCAGGGACCAGCACTTTCTTCTTCTAATGAT
CTCCCTTTAGATGAGCTGCGCCGTCGAAGAGTAGAAAGGTTTAGTTGA