Details for Lyrate rockcress Locus 16043272

Position : sca3 ( 5`- 10074842 .. 10074342 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043272

Protein [Map View]
MRVHPIPRNLNNTLIHHHHNPTREPGKNLRRLPHIFNRVLELPLRSEADVTVEERHDCFRFVAETVGLCDGDGEMRAYMV
EIHPGITKIVVRTNGSSSLGLSLDELELDVWRFRLPESTRPELVTVACVDGDLIVTVPKNAEEEDDDDGGGDFGQGMGSG
RLVLVQ*

DNA
ATGAGAGTCCACCCAATTCCCAGAAACCTCAACAATACTTTGATCCATCATCACCATAACCCGACCCGAGAACCCGGAAA
GAATCTCCGGCGATTGCCACATATCTTCAACCGTGTTCTGGAGCTGCCATTGAGGTCAGAGGCAGATGTAACAGTGGAAG
AGAGACACGACTGTTTTCGATTCGTGGCGGAGACGGTAGGTCTTTGTGACGGTGATGGAGAAATGAGGGCTTATATGGTT
GAGATTCATCCGGGTATAACCAAGATCGTTGTTAGGACAAATGGGTCGTCTTCTCTTGGTTTGTCTTTAGACGAGTTAGA
GCTTGACGTGTGGCGTTTTAGGCTACCGGAATCTACTAGGCCTGAGCTTGTTACTGTGGCTTGTGTTGATGGAGATTTGA
TTGTTACTGTGCCTAAGAATGCTGAAGAAGAAGATGATGATGATGGTGGTGGTGATTTTGGACAAGGTATGGGTAGTGGA
AGGCTGGTGCTTGTTCAGTGA