Details for Lyrate rockcress Locus 16043143

Position : sca3 ( 5`- 7254294 .. 7256319 -3` )
Annotation : [B2G] transcriptional factor b3 family protein
External links : CoGe
PGDD synteny : 16043143

Protein [Map View]
MGRRRNIGFDKIIEERKMLSFFKIFQSSDLSSECMRAFSYSFISRLSRKDFSYKMVIRAQWGKTWHLEISKNPRYYYIER
RGWDQFVSDNALGENEFITFTHRGNMVFHVNIYEQNGVEMLTPRKFQTMDSSSGIKKEGESSFKDVKKEEETDESAGRAE
FVVRKRKTEESKSSKKKMERKKKKSKSKSKSKEVLNGVPEFKITIRKSYLKFLAIPKHFVDDHIPNKSKFFTVRHPNGIG
SWKVLCLVREIRTIFSGGYSKLAREYPLMVGDKCTFKLIKPFEFVLLTSKKTRDEIDHYMID*

DNA
ATGGGTAGGAGAAGGAACATTGGTTTTGATAAAATTATAGAAGAACGGAAGATGTTGAGCTTTTTCAAGATTTTTCAGAG
TTCAGATCTATCTTCTGAATGCATGAGAGCGTTTTCTTACAGCTTCATAAGTAGACTCTCAAGGAAAGACTTCTCTTACA
AGATGGTGATAAGAGCGCAATGGGGAAAGACATGGCATCTAGAAATCTCCAAGAACCCGAGATACTACTACATTGAGAGG
CGTGGATGGGATCAGTTTGTGAGTGACAATGCTTTAGGAGAAAACGAGTTCATTACCTTCACTCACAGAGGAAATATGGT
CTTTCATGTCAACATCTACGAGCAGAATGGTGTAGAGATGCTCACACCTCGAAAATTCCAGACAATGGATTCTTCTAGTG
GGATCAAGAAAGAAGGAGAGAGTAGCTTCAAAGATGTGAAGAAGGAAGAGGAAACTGATGAATCCGCGGGACGAGCTGAG
TTCGTAGTTAGAAAGAGGAAGACTGAGGAATCCAAATCATCCAAGAAGAAGATGGAGAGAAAGAAAAAGAAGAGCAAGAG
CAAGAGTAAGAGCAAAGAAGTGCTGAATGGTGTTCCAGAATTCAAAATCACCATAAGGAAATCATACCTCAAGTTCCTGG
CAATCCCAAAACATTTTGTGGATGATCATATCCCGAATAAGTCTAAGTTTTTCACGGTTCGTCACCCGAATGGGATTGGT
TCATGGAAGGTGCTCTGCTTGGTGAGGGAGATTAGGACAATCTTCTCAGGTGGATACTCAAAATTGGCAAGAGAGTATCC
TTTAATGGTTGGTGACAAATGCACCTTCAAGCTCATCAAACCCTTCGAGTTTGTCCTTCTTACCTCCAAGAAGACCAGAG
ATGAGATTGATCACTACATGATCGATTGA