Details for Lyrate rockcress Locus 16043136

Position : sca2 ( 5`- 16462154 .. 16459065 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043136

Protein [Map View]
MNLAIPNPNSHQLSFLIQNSSFIGNRRFADGNRLRFLSGGNRKPSSVAGKIKAKTKDLVLGNPSVSVEKGKYSYDVESLI
NKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRGDWQRSLRLFKYMQRQIWCKPNEHIYTIMISLLGREGLLDKC
LEVFDEMPSQGVSRSVFSYTALINAYGRNGRYETSLELLDRMKNDKISPSILTYNTVINACARGGLDWEGLLGLFAEMRH
EGIQPDIVTYNTLLSACAIRGLGDEAEMVFRTMNDGGIVPDLTTYSHLVETFGKLRRLEKVSDLLSEMASGGSLPDITSY
NVLLEAYAKSGSIKEAMGVFHQMQAAGCTPNANTYSVLLNLFGQSGRYDDVRQLFLEMKSSNTDPDAATYNILIEVFGEG
GYFKEVVTLFHDMVEENIEPDMETYEGIIFACGKGGLHEDARKILQYMTANDIVPSSKAYTGVIEAFGQAALYEEALVAF
NTMHEVGSNPSIETYHSLLYSFARGGLVKESEAILSRLVDSGIPRNRDTFNAQIEAYKQGGKFEEAVKTYVDMEKSRCDP
DERTLEAVLSVYSFARLVDECREQFEEMKASDILPSIMCYCMMLAVYGKTERWDDVNELLEEMLSNRVSNIHQVIGQMIK
GDYDDDSNWQIVEYVLDKLNSEGCGLGIRFYNALLDALWWLGQKERAARVLNEATKRGLFPELFRKNKLVWSVDVHRMSE
GGMYTALSVWLNDMNDMLLNGEDLPQLAVVVSVRGQLEKSSAARESSIAKAAFSFLQDHVSSSFSFTGWNGGRIMCQRSQ
LKQLLSTKEPTLEESQNKNLVALANSPILAGGTRASTSNDTNHSGNPTQRRTRVKKELAGSTA*

DNA
ATGAACCTAGCAATTCCAAATCCCAACTCACACCAGCTCTCCTTCCTCATCCAAAATTCCAGTTTCATCGGAAACCGGAG
ATTCGCCGACGGAAACCGTCTTCGTTTCCTTTCAGGTGGAAACCGTAAACCAAGCTCCGTCGCCGGTAAAATCAAAGCGA
AGACAAAAGATCTCGTTCTGGGAAACCCTTCCGTCTCCGTGGAGAAAGGAAAGTACAGCTACGACGTCGAATCGCTGATT
AACAAGCTGAGCAGTCTTCCACCACGCGGGAGCATCGCCAGGTGCTTAGACATATTCAAGAACAAGCTTTCGCTGAACGA
TTTCGCACTCGTGTTCAAAGAGTTCGCTGGTCGCGGCGACTGGCAAAGGTCGCTTCGTCTCTTCAAGTATATGCAACGGC
AGATATGGTGCAAACCAAACGAGCACATCTACACTATTATGATCTCTTTGCTTGGTAGGGAAGGTCTTCTAGACAAATGT
CTTGAGGTATTCGACGAAATGCCTAGCCAAGGTGTGTCACGCAGTGTTTTCTCTTACACGGCTTTGATCAATGCTTATGG
TCGAAATGGACGGTATGAGACCTCTCTTGAGCTTCTTGATAGGATGAAGAACGATAAGATATCACCTAGTATTTTGACTT
ACAACACTGTGATTAATGCTTGTGCTAGAGGTGGTTTAGATTGGGAGGGTTTATTGGGTTTGTTTGCAGAGATGAGACAT
GAGGGGATACAACCCGACATCGTGACATATAATACACTGCTTAGTGCTTGTGCTATTAGAGGTTTAGGTGATGAGGCTGA
AATGGTTTTTAGGACTATGAATGATGGTGGGATAGTTCCGGATCTAACCACATATAGTCATCTAGTTGAGACATTTGGGA
AGTTACGCCGGCTGGAAAAAGTGTCTGATCTCCTGAGTGAGATGGCTTCCGGGGGCAGTTTACCGGATATCACTTCTTAT
AATGTGTTGTTAGAGGCATATGCGAAATCCGGGTCTATTAAGGAGGCAATGGGGGTCTTCCATCAGATGCAGGCTGCAGG
GTGCACGCCGAACGCAAATACATATAGTGTTTTACTGAATTTGTTTGGACAGAGTGGGAGGTATGATGATGTTCGGCAGC
TTTTTCTTGAGATGAAATCAAGCAATACAGATCCTGATGCTGCTACATACAACATTTTGATAGAGGTTTTTGGGGAAGGT
GGGTATTTTAAGGAAGTGGTAACTTTGTTCCATGATATGGTGGAGGAGAATATTGAACCTGACATGGAGACATATGAGGG
TATAATATTTGCTTGTGGGAAGGGAGGACTCCACGAAGATGCTAGGAAGATTTTACAATATATGACAGCTAATGATATCG
TGCCAAGCTCCAAGGCATACACTGGGGTTATTGAAGCGTTTGGGCAGGCTGCTTTATATGAAGAAGCACTTGTTGCTTTT
AACACCATGCATGAAGTAGGAAGCAATCCAAGTATTGAAACATACCACTCACTGTTATATTCTTTTGCAAGGGGAGGACT
GGTCAAGGAGTCTGAGGCGATTTTGTCCCGGTTGGTGGATTCTGGTATTCCCAGGAACAGAGATACGTTCAATGCACAAA
TAGAAGCCTACAAGCAAGGAGGCAAATTTGAAGAGGCTGTGAAGACATATGTAGATATGGAGAAGTCAAGATGCGATCCT
GATGAAAGGACGCTTGAGGCTGTTTTAAGTGTGTATTCTTTTGCACGACTTGTCGATGAGTGCAGGGAGCAGTTTGAGGA
AATGAAAGCTTCTGATATACTGCCCAGTATCATGTGCTACTGTATGATGCTAGCTGTGTATGGAAAGACAGAGAGGTGGG
ACGATGTCAATGAGTTACTGGAGGAGATGCTTTCAAATAGAGTGTCAAATATTCATCAAGTTATTGGGCAAATGATCAAG
GGAGATTATGATGATGACTCAAATTGGCAGATAGTGGAATATGTGTTGGACAAACTCAATTCAGAAGGATGTGGTTTGGG
AATAAGGTTTTACAATGCACTTCTGGATGCTTTGTGGTGGCTGGGCCAGAAAGAGCGAGCTGCAAGGGTACTCAATGAGG
CAACAAAACGTGGACTTTTCCCTGAGTTATTCCGGAAAAACAAACTTGTGTGGTCTGTTGATGTACATAGGATGTCAGAG
GGTGGCATGTACACGGCACTATCGGTTTGGCTAAATGATATGAATGATATGCTATTAAATGGAGAGGATCTTCCTCAACT
AGCTGTTGTTGTTTCAGTACGGGGACAATTGGAGAAAAGCTCCGCTGCAAGAGAATCTTCTATCGCGAAAGCTGCTTTCT
CCTTCTTGCAGGATCATGTCTCGTCATCATTTTCCTTCACGGGATGGAATGGAGGTCGCATTATGTGCCAGCGATCTCAG
CTCAAGCAGTTGCTGTCAACGAAAGAACCAACCTTAGAAGAGTCCCAAAATAAAAACCTAGTCGCTTTAGCAAACTCGCC
AATATTAGCTGGTGGAACAAGAGCTTCAACAAGCAATGACACGAACCACAGCGGTAACCCTACACAACGAAGAACCAGGG
TGAAAAAAGAACTAGCAGGGAGCACAGCTTAA