Details for Lyrate rockcress Locus 16043134

Position : sca3 ( 5`- 9523501 .. 9527568 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043134

Protein [Map View]
MAKANQNFSAYQETQPIDSNPSSPSDSGEDKDSLLGDCDTQPFEDDAWINDQYMETQVIDIECDNEEFLLCNETQAVDLG
FENGEEVFVEGTQLLEASDGLATQVLDLCDDEVVVDSEDDVTDVLEDNSELSDSDDSCSKAETVLSSEENRQDANEKVKS
TVALDANWSNEHGVSGKKVARFASVRSSAFRASAVAARAANPNTDCSTLINCHSSGKGATHNSSLENSVGEVGNQQSLTS
IFVEEKNDLRTANKTARKLFIEDLPEENCHSTDGNVDLGNLSYIDSQEPGEASQASALNLVDKLISECRLEFDFEVEADY
GRKTEEKSKFVQIFKGPQELAKKVSYKSGAVGNDIFDWDDNREDEGGGDIYRRRKDEFFGVASKRREFSSLPREQKRELI
PVAVDKRRASDSKLLQHSVTRSRKNIQGAKKNLGKELDEVREAVVLGNYTQVAAEAIDDLSSGACGKFDAEASCLTGKKL
SPGEERGFSPGGVVTRQSKGTKRIQAMSKDELLKKRMKKASPSPAKACRRNIEGSLKGDQLDKEGPSEPISKTKSTRKRR
DLGSIRVLFSQHLDEDVTKHQKKILARFDISEASSMKEATHFLADNFTRTRNMLEAIASGKPVVTTQWLESIDQVSIYVD
EDMYILRDSKKEKEFCFNMGVSLARARQFPLLQGRRVFITPNTKPGLNTITTLVKAVHGLPVERLGRSALSEDKVPENLL
VLSCEEDRATCIPFLERGAEVYSSELLLNGIVTQRLEYERYRLFTDHVRRTRSTIWIKDGKGKFQRRSG*

DNA
ATGGCTAAAGCAAATCAAAACTTTTCTGCGTATCAAGAGACCCAACCGATTGATTCTAATCCCTCTTCTCCTTCTGATTC
TGGTGAAGATAAAGATAGCTTGCTTGGGGATTGTGACACACAACCTTTTGAAGACGATGCTTGGATTAATGATCAATATA
TGGAGACTCAGGTCATTGATATTGAATGTGATAATGAAGAATTTCTTCTTTGTAATGAAACTCAAGCGGTTGATTTGGGA
TTTGAAAACGGAGAAGAAGTATTTGTAGAGGGGACACAGTTACTTGAAGCTTCTGATGGTTTGGCTACTCAGGTTTTGGA
TCTTTGTGATGATGAAGTTGTTGTGGATAGTGAGGATGATGTTACTGATGTCTTGGAGGATAACAGTGAGCTCTCTGATA
GTGATGACTCGTGTAGTAAAGCGGAAACTGTGTTATCTAGTGAAGAGAATAGACAGGATGCTAATGAAAAGGTTAAATCA
ACAGTTGCCCTTGATGCTAATTGGTCGAACGAACATGGAGTTTCGGGGAAAAAGGTGGCTAGGTTCGCTTCAGTTCGTTC
ATCAGCTTTTCGTGCTTCTGCTGTGGCAGCTCGTGCGGCAAACCCCAACACTGACTGTTCTACTCTAATCAACTGTCATT
CTTCTGGGAAAGGAGCCACACATAATTCTAGTCTAGAAAATAGTGTTGGAGAAGTAGGGAATCAGCAATCTCTTACCAGT
ATATTTGTTGAAGAGAAAAATGACTTAAGAACAGCAAACAAAACAGCGAGGAAGCTTTTCATTGAGGATTTGCCTGAAGA
AAATTGTCATTCTACTGATGGCAATGTCGATCTGGGGAATTTGAGTTATATTGACTCTCAAGAACCTGGCGAGGCATCCC
AGGCCAGTGCTCTTAACTTGGTTGATAAGCTCATTAGTGAGTGCCGTCTAGAGTTTGATTTTGAAGTTGAAGCTGACTAT
GGAAGGAAAACAGAAGAAAAATCAAAATTTGTTCAGATTTTTAAAGGTCCACAAGAATTAGCAAAGAAAGTAAGTTACAA
AAGCGGAGCTGTTGGAAACGATATTTTCGACTGGGATGATAATCGTGAGGATGAAGGAGGGGGTGATATCTATCGTAGAA
GAAAAGATGAATTCTTTGGCGTTGCAAGTAAAAGACGGGAATTTTCTAGCTTGCCTAGAGAACAGAAAAGAGAACTGATA
CCAGTTGCTGTGGATAAAAGAAGGGCTTCTGATTCCAAACTGTTGCAGCATAGTGTGACTAGGAGCCGAAAAAATATCCA
GGGTGCTAAAAAGAATCTTGGCAAAGAGTTAGATGAAGTTCGTGAAGCGGTAGTTTTAGGGAATTATACACAAGTGGCTG
CTGAAGCGATTGATGATCTGTCCTCTGGAGCCTGTGGCAAGTTTGATGCTGAGGCGAGTTGTCTTACAGGAAAGAAACTG
TCACCAGGAGAAGAGAGAGGATTTTCTCCCGGTGGAGTCGTTACTAGACAATCCAAGGGAACTAAGAGGATTCAGGCTAT
GAGTAAAGATGAATTGTTGAAAAAAAGAATGAAGAAGGCTAGTCCAAGTCCTGCTAAAGCTTGCCGGAGGAATATTGAAG
GGTCTTTAAAGGGTGACCAGCTTGATAAAGAAGGTCCATCGGAACCTATCTCCAAGACAAAGAGTACTAGAAAGAGAAGA
GATTTGGGTAGTATACGTGTCCTGTTCAGCCAGCATCTTGATGAAGATGTGACCAAGCATCAGAAGAAGATTTTGGCAAG
GTTTGATATCTCGGAAGCTTCCTCCATGAAGGAGGCAACACACTTCTTAGCTGATAACTTTACGCGCACAAGGAACATGC
TAGAGGCAATCGCTTCAGGCAAGCCAGTGGTCACAACACAATGGCTTGAAAGCATCGATCAAGTAAGCATATACGTTGAC
GAGGATATGTATATACTCAGAGATTCAAAAAAGGAGAAGGAGTTCTGTTTCAACATGGGGGTTTCTTTGGCTCGTGCACG
CCAGTTTCCGCTACTACAGGGGAGAAGAGTTTTTATCACCCCAAATACAAAGCCTGGTTTAAACACAATCACGACTTTGG
TTAAGGCTGTTCATGGACTGCCTGTAGAAAGACTCGGAAGATCTGCCCTAAGTGAAGATAAGGTCCCAGAGAATCTTCTG
GTCTTATCATGTGAAGAGGATCGCGCTACCTGCATACCGTTTCTAGAAAGAGGGGCCGAGGTATATAGCTCGGAGTTACT
ACTGAATGGGATAGTTACTCAAAGGCTTGAGTATGAGAGGTACCGTCTCTTCACAGACCATGTGAGAAGAACGCGGTCAA
CGATATGGATCAAAGACGGCAAAGGTAAGTTTCAACGCCGTAGCGGGTAA