Details for Lyrate rockcress Locus 16043126

Position : sca3 ( 5`- 5245742 .. 5247736 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043126

Protein [Map View]
MADGKSRFTVDKALVAMGFGKFQLYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSAREESLITSVVFAGMLIGAYSW
GIVSDKHGRRKGFIITAVVTFIAGFLSAFSPNYMWLIILRCLVGLGLGGGPVLASWYLEFIPAPSRGTWMVVFSAFWTVG
TIFEASLAWVVMPSLGWRWLLALSSVPSSLLLLFYRWTSESPRYLILQGRKAEALSILEKIARMNGTQLPPGVLSSELET
ELEDNKNLPTENTHLLKPGEIGEAVAVSKIVLKADKEPAFSLLALLSPTLIKRTLLLWIVFFGNAFAYYGVVLLTTELNN
SHNRCYPTEKQLGNSNDVNYKDVFIASFAEFPGLLISAAMVDRLGRKVSMASMLFTCCIFLLPLLSHQSPFITTALLFGG
RICISAAFTVVYIYAPEIYPTAVRTTGVGVASSVGRIGGILCPLVAVGLVHGCHQTIAVLLFEVVILVSGICVCLFPFET
SGRDLTDSISASKEPPSASV*

DNA
ATGGCAGATGGGAAGTCAAGATTCACGGTGGATAAAGCTCTTGTGGCGATGGGATTTGGCAAGTTCCAACTTTACGTCCT
TGCTTACGCTGGAATGGGTTGGGTTGCAGAGGCCATGGAGATGATGCTTCTCTCTTTCGTAGGACCTGCTGTTCAATCGC
TCTGGAATCTCTCTGCACGAGAGGAAAGCTTAATTACCAGTGTCGTTTTTGCTGGTATGCTCATTGGAGCTTACTCTTGG
GGCATTGTTTCTGACAAACATGGCCGCAGGAAAGGATTTATCATAACTGCGGTGGTGACTTTTATAGCTGGTTTCTTGAG
CGCCTTTTCACCAAACTACATGTGGTTGATCATTCTTCGCTGTTTGGTTGGTCTTGGGTTGGGAGGAGGTCCTGTTCTTG
CTTCTTGGTATCTTGAATTCATACCTGCACCAAGCCGAGGGACTTGGATGGTTGTTTTCTCAGCTTTCTGGACCGTTGGA
ACCATATTCGAGGCTTCCCTTGCTTGGGTGGTCATGCCAAGTCTGGGTTGGAGGTGGTTACTTGCACTCTCTTCTGTACC
TTCATCGTTGCTTCTTCTCTTCTATAGGTGGACATCCGAGTCTCCTCGGTACTTAATCCTACAAGGCCGGAAAGCTGAAG
CTCTTTCCATATTAGAGAAGATTGCGAGAATGAACGGAACCCAACTACCTCCGGGTGTTCTCAGTTCAGAATTGGAGACC
GAGCTGGAAGACAATAAAAACCTTCCAACAGAAAACACTCATCTTCTCAAGCCTGGAGAAATTGGAGAAGCTGTTGCTGT
GTCCAAGATTGTACTAAAAGCTGATAAGGAACCAGCTTTCTCGTTACTAGCTCTTCTATCTCCAACGCTAATCAAGCGGA
CTTTGCTACTATGGATTGTGTTCTTTGGAAATGCGTTTGCTTATTATGGCGTTGTCCTTCTCACCACTGAGCTGAACAAT
TCCCATAACCGCTGCTATCCAACCGAGAAACAGTTGGGAAATTCAAACGATGTTAACTACAAAGACGTTTTCATCGCCAG
TTTTGCAGAGTTTCCAGGTCTACTGATATCAGCAGCAATGGTGGATAGACTTGGACGAAAAGTTTCAATGGCATCAATGT
TATTCACTTGTTGCATATTCCTTCTCCCTCTGTTATCTCATCAATCTCCATTCATAACCACTGCTCTTCTCTTTGGTGGC
CGTATCTGCATCTCTGCGGCTTTCACAGTGGTTTACATATATGCTCCGGAGATATATCCAACGGCAGTGAGAACAACCGG
AGTAGGAGTGGCGAGCTCGGTAGGACGAATCGGAGGAATCTTGTGTCCACTAGTGGCCGTTGGATTAGTTCACGGATGTC
ATCAGACGATTGCTGTTCTTCTGTTTGAGGTTGTGATTCTTGTCTCAGGAATTTGTGTTTGTCTCTTCCCTTTCGAGACA
AGTGGTCGTGACCTGACAGATAGTATCTCGGCGTCCAAAGAACCACCTTCAGCTTCTGTATAG