Details for Lyrate rockcress Locus 16043097

Position : sca3 ( 5`- 8671898 .. 8672902 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16043097

Protein [Map View]
MSSGVNSTGSAATEPEVDKMFFCYQCNRTVTISISSSADPFCPICNQGFLEEYEDPNPNPSLNFNPNSVDSLFPMADPFS
TLLPLLFGSSAASPSGIDLMSSSFFAPSMQPQARSTQQNPQSDAFDPFTFLQNHLQNLRSSGTHVQFVIENHPSDLGNRM
PGNFGDYFFGPGLEQLIQQLAENDPNRYGTPPASKSAIDGLPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVF
HQDCLLPWLQLHNSCPVCRFELPTDDPDYENRTQGIQASGDGQGSVEGQQTPRFSIQLPWPFRRQDGSGSGSGAPGASGG
NLETRGEDLD*

DNA
ATGTCTTCCGGCGTAAATTCAACTGGCTCCGCCGCAACAGAACCGGAGGTCGACAAGATGTTCTTCTGCTACCAGTGCAA
TCGCACAGTGACAATCTCAATTTCCTCATCCGCTGATCCTTTTTGTCCAATTTGTAACCAAGGGTTTCTTGAAGAATACG
AAGACCCTAACCCTAATCCATCCCTCAATTTCAACCCTAACTCTGTTGATTCCCTTTTCCCCATGGCTGATCCTTTCTCC
ACCTTGCTCCCTCTCTTATTCGGCTCTTCCGCTGCCTCTCCTTCCGGCATTGACTTGATGAGCTCGAGCTTCTTCGCTCC
GTCGATGCAACCACAGGCTCGCTCCACTCAGCAGAATCCCCAGTCTGACGCGTTTGATCCGTTTACGTTTCTTCAGAATC
ATCTCCAGAATCTGCGATCTAGCGGTACGCACGTTCAGTTCGTGATCGAGAATCATCCTTCGGATCTAGGTAATCGTATG
CCTGGGAATTTCGGTGACTACTTCTTTGGTCCAGGTCTTGAGCAGCTGATTCAGCAGCTAGCTGAGAATGATCCTAATCG
TTACGGAACTCCTCCTGCTTCCAAATCCGCCATTGATGGGCTTCCTACTGTTAAGGTAACGAAGGATATGTTGAAATCCG
AGATGAACCAGTGTGCCGTGTGTATGGATGAGTTTGAGGATGGTAGCGATGTTAAACAGATGCCTTGTAAGCATGTCTTT
CATCAGGATTGCTTGCTCCCGTGGCTCCAGTTGCATAACTCATGTCCGGTTTGTCGATTCGAGTTGCCTACGGATGATCC
TGACTATGAGAACAGGACTCAAGGAATTCAGGCGAGTGGCGATGGACAAGGATCGGTTGAGGGTCAGCAGACGCCGAGGT
TTAGTATACAACTTCCTTGGCCGTTCAGGAGACAAGATGGCTCTGGTTCTGGCTCGGGAGCACCTGGTGCCAGTGGAGGT
AATCTTGAGACCAGGGGGGAAGATTTGGATTAA