Details for Lyrate rockcress Locus 16043086

Position : sca3 ( 5`- 3814355 .. 3815984 -3` )
Annotation : [B2G] 60s ribosomal protein l4 l1
External links : CoGe
PGDD synteny : 16043086

Protein [Map View]
MAAAAARPLVTVQVLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSR
IPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMKRHAIVSAIAATAVPSLVMARGHKIENVPEMPLVVS
DSAEAVEKTSAAIKVLKQIGAYDDAEKAKDSIGIRPGKGKMRNRRYISRKGPLVVYGTEGAKIVKAFRNLPGVELCHVER
LNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEIQSVVKPIKKDSKRAVL
KKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLSKKRKTVTKEEALAIKAAGKSWYQTMISDSDYTEFDNFTK
WLGASQ*

DNA
ATGGCCGCCGCCGCTGCTCGTCCTCTCGTCACCGTCCAAGTTTTGGATGGTGACATGTCCACCGATCAATCCTCCACCGT
CGTATTACCCGACGTCATGACGGCGCCAGTTCGTCCAGACATCGTTAACTTTGTCCACGCCCAAATCTCCAACAACAGCC
GTCAGCCTTACGCCGTCTCAAAGAAGGCCGGTCACCAGACCTCCGCGGAGTCCTGGGGAACCGGACGTGCCGTGTCTCGT
ATCCCTCGTGTTCCTGGTGGTGGTACTCACCGTGCTGGTCAAGCTGCGTTCGGTAACATGTGTCGTGGTGGTCGGATGTT
CGCTCCAACCAAGATCTGGCGCCGCTGGCACCGTCGTGTCAATGTCAACATGAAGCGTCACGCAATCGTCTCAGCCATCG
CCGCAACTGCTGTTCCTTCGCTTGTGATGGCTCGTGGTCACAAGATCGAGAATGTTCCTGAGATGCCTCTTGTTGTGAGT
GACTCCGCAGAAGCTGTGGAGAAGACCTCAGCTGCGATCAAGGTACTGAAACAGATCGGGGCTTATGATGATGCTGAGAA
GGCAAAGGATAGCATTGGGATCCGTCCTGGTAAAGGTAAAATGAGGAACCGTCGTTACATTTCTAGGAAAGGTCCTCTTG
TGGTTTATGGAACTGAAGGAGCTAAGATAGTTAAGGCGTTTAGGAATCTTCCTGGTGTTGAGCTCTGTCATGTGGAGAGG
CTTAATTTGTTGAAGCTTGCTCCTGGTGGTCACCTTGGGCGGTTTGTGATCTGGACCAAGTCTGCTTTTGAGAAGCTTGA
GTCTATCTATGGTTCGTTTGAGAAGCCATCAGAGAAAAAGAAGGGATATGTGCTTCCTCGTGCAAAGATGGTGAATGCTG
ATCTTGCCAGGATTATCAACTCAGATGAGATTCAGAGTGTTGTGAAGCCGATCAAGAAGGATTCGAAGAGGGCTGTTCTT
AAGAAGAATCCATTGAAGAATCTGAATGTGATGTTGAAGCTGAATCCTTATGCTAAGACTGCTAAGAGGATGTCACTGTT
GGCTGAAGCACAAAGAGTTAAGGCTAAGAAGGAGAAGCTTTCCAAGAAGAGGAAAACCGTTACCAAGGAGGAGGCGTTGG
CAATCAAAGCAGCAGGCAAGTCGTGGTACCAGACTATGATCTCCGACAGTGATTACACCGAGTTTGATAACTTCACCAAA
TGGCTCGGTGCTAGCCAGTAA