Details for Lyrate rockcress Locus 16043083

Position : sca3 ( 5`- 22263543 .. 22261737 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043083

Protein [Map View]
MANSWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNSEMNQRSEILEPLQGLDD
ALRRSYILVKSCQEKSYLYLLAMGWNIVNQFEKAQTEIDLFLKIVPLINMADNARIRERLEAIERDQREYTLDEEDKKVQ
DVILKQESTREAATSVLKKTLSRSYPNMGFCQALKTEEEKLQLELHRSRARYDADQCEVIQRLIDVTQTAASSVEPDLEK
VLTKKEELTSSKKKDDLYDTDSWSLMVECRSTSYVSSGHELLSGRSSQHHENWHADLLDCCSEPCLCFKTFFFPCGTLAK
ISTMATDRQISSTEACKNLMVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCALVQELREVEIRGVSYGT
EMSNKEMSPPTPQFMEE*

DNA
ATGGCTAATTCATGGGATCAGTTAGGAGAAATTGCGTCAGTAGCTCAGCTTACAGGCATAGACGCCCTGAAACTGATTGG
AATGATAGTAAACGCTGCGAATACAGCTCGAATGCACAAGAAGAATTGTCGTCAATTCGCTCACCATCTTAAGCTCATCC
GTAATTTGCTAGAGCAGATAAAAAACTCTGAGATGAATCAACGTTCAGAGATTCTTGAGCCGCTTCAAGGACTTGATGAT
GCTCTTAGAAGATCTTACATTTTAGTCAAAAGTTGTCAAGAAAAGAGTTATCTTTACTTGTTGGCTATGGGATGGAACAT
TGTTAACCAGTTTGAAAAAGCTCAGACCGAGATTGATCTGTTTCTCAAGATCGTTCCACTCATAAATATGGCGGATAATG
CTCGCATTCGGGAGAGGTTAGAAGCTATTGAACGTGATCAGCGTGAGTACACTCTTGATGAAGAGGATAAAAAGGTGCAA
GATGTTATTTTGAAACAAGAATCCACTAGAGAAGCAGCTACATCGGTTTTAAAGAAAACGCTTTCTCGTTCCTACCCGAA
CATGGGGTTCTGCCAAGCGCTTAAAACAGAGGAGGAGAAACTGCAACTTGAGTTACATCGTTCGCGGGCGCGGTATGATG
CAGATCAATGTGAAGTTATACAACGTTTGATTGATGTTACACAAACTGCTGCTTCTTCTGTTGAACCTGATCTTGAAAAG
GTTTTGACTAAGAAAGAAGAGCTTACCTCTAGCAAGAAGAAAGATGATTTGTATGACACGGATAGTTGGTCTCTAATGGT
TGAATGTAGATCAACGTCTTATGTTTCATCCGGACATGAACTACTTTCGGGAAGATCATCGCAACACCATGAAAATTGGC
ACGCCGACTTGCTGGATTGTTGTTCAGAACCTTGTCTTTGCTTCAAGACATTCTTTTTCCCGTGTGGTACATTGGCAAAG
ATTTCTACTATGGCAACTGACAGGCAAATCTCTTCAACTGAAGCGTGTAAGAACCTAATGGTGTATTCTTTGATACTCTC
ATGCTGTTGCTATACTTGCTGCATAAGGAAGAAGCTTCGAAAGACTCTGAACATAACGGGAGGGTGCATTGACGACTTTT
TGTCACATCTAATGTGTTGTTGTTGTGCCCTTGTCCAAGAACTGAGAGAAGTCGAGATTCGTGGAGTTTCTTACGGTACA
GAGATGAGTAATAAGGAAATGAGTCCACCAACACCTCAGTTCATGGAAGAATGA