Details for Lyrate rockcress Locus 16043077

Position : sca3 ( 5`- 737673 .. 736740 -3` )
Annotation : [B2G] dimethylmenaquinone methyltransferase family protein
External links : CoGe
PGDD synteny : 16043077

Protein [Map View]
MAFVTTAEVCDANQELIRSGQLRALQPNFQIYGRRQIFSGPVVTVKVFEDNGLIRHFLEEKGNGRVLVVDGGGSLRCAIL
GGNPVVQAQNNGWAGIIVNGCIRDVDEINGCDIGVRALASHPIKASKKGLGEQRVPLNIAGTRICDGEWLYADTDGILVS
QIELSV*

DNA
ATGGCGTTTGTGACCACTGCGGAAGTTTGTGACGCGAATCAAGAACTGATTCGTAGTGGCCAGCTCCGAGCTCTGCAACC
CAATTTCCAGATTTACGGTCGTCGTCAAATATTTTCAGGTCCAGTAGTTACTGTCAAAGTATTTGAAGACAATGGCTTAA
TCCGTCACTTCCTCGAAGAAAAAGGGAATGGAAGAGTTCTTGTGGTGGACGGTGGAGGGAGTTTACGCTGTGCGATACTA
GGAGGAAACCCAGTAGTACAAGCGCAGAACAACGGATGGGCAGGGATCATAGTGAACGGTTGCATCAGAGACGTTGATGA
GATCAATGGTTGCGACATTGGAGTGAGAGCTTTAGCTTCTCATCCAATAAAGGCGAGTAAGAAAGGACTTGGTGAACAAA
GAGTCCCTTTGAACATAGCAGGCACTCGGATATGCGATGGCGAATGGCTTTATGCAGATACTGATGGTATCCTTGTTTCT
CAGATTGAATTATCCGTTTAA