Details for Lyrate rockcress Locus 16043063

Position : sca3 ( 5`- 5306134 .. 5305814 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043063

Protein [Map View]
MEFREKLLKFKFQIVFAFVLSLLTVALVTYSPGFLTVLSYFWPLILSTALFLAAVFFFARTSDLPASSTIIPGEGAGLKV
AAEGILDYVVGGQHEDILFDSFTKLD*

DNA
ATGGAGTTCCGGGAGAAGCTTTTGAAGTTTAAGTTCCAAATCGTCTTTGCCTTTGTTTTATCTCTCCTCACCGTAGCCCT
CGTCACTTATTCTCCCGGTTTCCTCACCGTTTTATCTTACTTCTGGCCACTTATTCTCTCCACCGCTCTCTTTCTCGCCG
CTGTTTTCTTCTTCGCACGCACCTCCGACCTTCCGGCTTCATCTACCATCATCCCAGGCGAAGGCGCCGGCTTAAAAGTG
GCGGCGGAAGGGATTCTTGACTATGTCGTCGGCGGACAACACGAAGACATTCTGTTTGATAGCTTCACCAAACTTGACTA
A