Details for Lyrate rockcress Locus 16043039

Position : sca2 ( 5`- 16542582 .. 16544005 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043039

Protein [Map View]
MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCVEAGWVV
EEDGTTYRKGCKPLTGEIAGTSSRVTPYSSQNQSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNISSTFFPFLRNGG
IPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRQFHTPATIPECD
ESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTTAFQEIGQSSEFKFENSQVKPWEGERIHDVG
MEDLELTLGNGKARG*

DNA
ATGACGTCGGATGGAGCTACGTCGACATCAGCAGCTGCGGCTGCGGCGGCGGCAGCAGCGGCGAGGAGGAAGCCGTCGTG
GAGGGAAAGGGAGAATAATCGGAGGAGAGAGAGACGGAGAAGAGCTGTAGCTGCGAAGATATATACTGGGCTTAGAGCTC
AAGGTGATTATAATTTGCCTAAACATTGTGATAATAATGAAGTCCTCAAAGCTCTTTGTGTTGAAGCTGGTTGGGTTGTT
GAAGAAGATGGTACTACTTATCGCAAGGGATGCAAGCCTTTAACTGGTGAGATAGCTGGGACATCGTCTCGAGTTACTCC
ATACTCATCACAGAACCAGAGCCCTCTTTCATCGGCCTTTCAAAGCCCCATCCCGTCTTACCAAGTGAGCCCGTCTTCTT
CGTCTTTCCCGAGTCCTTCTCGCGGTGAACCAAATAACAACATCTCCTCTACATTCTTCCCCTTCCTCAGAAATGGTGGC
ATTCCTTCCTCTCTTCCTTCCCTCAGAATCTCGAACAGTTGTCCAGTTACCCCACCGGTCTCATCACCGACTTCCAAGAA
CCCTAAACCGTTGCCCAACTGGGAATCTATCGCTAAGCAATCCATGGCCATTGCTAAACAATCCATGGCGTCTTTTAACT
ATCCTTTCTATGCTGTTTCTGCACCTGCTAGTCCGACACATCGCCAGTTTCATACCCCGGCTACTATACCTGAATGTGAT
GAGTCTGACTCTTCAACTGTTGATTCTGGTCATTGGATAAGCTTTCAGAAGTTTGCACAACAACAGCCATTCTCTGCTTC
TATGGTGCCAACCTCTCCTACCTTCAATCTTGTGAAACCCGCGCCTCAGCAGATGTCTCCAAATACTACTGCGTTCCAAG
AGATTGGTCAAAGCTCTGAATTTAAATTTGAGAATAGCCAAGTTAAGCCGTGGGAAGGAGAGAGGATACATGATGTGGGT
ATGGAGGATCTTGAGCTTACACTTGGAAACGGGAAGGCTCGTGGTTGA