Details for Lyrate rockcress Locus 16043029

Position : sca3 ( 5`- 12236634 .. 12238601 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16043029

Protein [Map View]
MDAMVSNFNKSTKLNVDSSPPMGYTENGSATYLSAGNPCLDFFFHVVPSTPKESLEKRLQEAWGHDALTTLKLICNLRGV
RGTGKSDKEGFYTAALWLHGHHPKTLACNLESISTFGYFKDFPEVLYRILQGSEIRSIQKLEWSQRKGGASRNRRARFSR
QTSRCGFGRGRRRGGGRGRGMGRRGLQIRPASTRQLRVEYAERKNQEEKARASLERKQKKVSMGMDAFTKYSNDPDYRFL
HERVSDLFANQLRRDLEFLTSGEPNKISLAAKWCPSLDSCFDKATLLCESIARKIFSRESFPEYEGVEDAHYAYRVRDRL
RKQVLVPLRKTLQLPEVYMGARDWESLPYNRVASVAMKSYKGFFLKHDAERFQQYLNDARMGKTTIAAGALLPHEIIREL
DWGGDGGQVAELQWKRMVDDLKEKGSLTNCMAISDVSGSMMGEPMEVSVALGLLVSELSEEPWKGKLITFSENPELHLVT
GDDLRSKTEFVRNMEWDMNTDFQKVFDLILRVAVEGKLRPQDMIKRVFVFSDMEFDQAPPPTPSNGWDTDYEVIVRKYRE
KGYGEAVPEIVFWNLRDSRSTPVLGNKKGVALVSGFSQNLIKVFLEHDGEIGDGDVDNGEIDPMMIMEAAISKDEYKSLV
VID*

DNA
ATGGACGCGATGGTCTCAAACTTCAACAAATCAACTAAACTCAACGTCGACTCTTCACCTCCCATGGGCTACACCGAGAA
TGGATCCGCCACGTACCTCTCCGCAGGCAACCCCTGCCTCGACTTCTTCTTCCACGTTGTTCCCTCCACGCCCAAGGAAT
CTCTTGAGAAGCGGCTACAAGAGGCTTGGGGCCACGACGCCTTAACCACCCTCAAGCTTATCTGTAACCTTCGTGGAGTC
CGTGGCACCGGAAAATCTGACAAGGAAGGGTTTTACACCGCGGCGTTGTGGCTCCATGGTCACCATCCCAAAACCCTAGC
TTGTAACCTCGAGTCCATCTCAACATTTGGTTACTTTAAAGATTTTCCAGAGGTTCTTTACCGGATTCTACAAGGATCTG
AAATCCGCAGTATCCAGAAATTGGAATGGAGCCAGAGGAAGGGCGGAGCATCTCGAAATAGAAGAGCTCGATTCTCTCGC
CAAACCTCGAGATGTGGTTTTGGTCGTGGTCGTAGAAGAGGTGGCGGAAGAGGTCGCGGAATGGGTCGCCGTGGCCTTCA
AATAAGGCCGGCCTCCACTAGGCAGCTGAGGGTAGAGTATGCAGAGAGGAAGAACCAAGAAGAGAAAGCCAGAGCAAGCT
TGGAGCGCAAGCAAAAGAAGGTTTCAATGGGAATGGACGCATTTACAAAATATTCTAACGATCCAGACTATAGGTTTCTC
CACGAACGCGTCTCTGACCTATTTGCCAATCAACTAAGGAGAGACCTTGAGTTTTTGACATCCGGCGAACCAAACAAAAT
CTCCCTAGCGGCTAAATGGTGTCCCTCACTTGATTCTTGCTTTGATAAAGCAACTCTTCTCTGCGAGAGCATTGCTAGGA
AGATCTTTTCCCGTGAATCATTCCCCGAATACGAAGGCGTTGAAGATGCTCACTATGCGTACAGAGTTCGTGATCGACTA
AGGAAACAGGTTCTTGTTCCTCTCCGGAAGACTCTGCAACTCCCTGAAGTATATATGGGAGCGAGAGATTGGGAATCTCT
CCCTTACAACCGTGTTGCATCAGTGGCGATGAAGTCGTACAAGGGTTTTTTCTTGAAACACGACGCTGAGAGGTTTCAGC
AATATCTTAACGATGCAAGGATGGGGAAAACGACGATAGCTGCGGGTGCTCTGTTACCTCACGAGATAATACGAGAATTA
GACTGGGGAGGAGACGGTGGACAAGTCGCTGAGCTGCAATGGAAACGAATGGTTGATGACCTTAAAGAGAAAGGTTCTTT
AACGAACTGCATGGCTATCTCTGACGTTTCGGGATCTATGATGGGTGAGCCAATGGAGGTTTCAGTCGCCCTTGGTTTGC
TAGTCTCTGAGCTATCAGAAGAGCCATGGAAAGGAAAGCTTATAACATTCAGCGAAAACCCTGAACTGCATTTGGTGACA
GGAGACGATTTGAGGTCAAAAACAGAGTTTGTGAGGAATATGGAATGGGATATGAACACTGATTTTCAGAAAGTGTTTGA
TTTGATTCTGAGAGTCGCCGTAGAAGGGAAGCTTAGGCCGCAAGATATGATCAAGAGGGTGTTTGTGTTCAGTGACATGG
AGTTTGATCAAGCACCGCCTCCGACTCCGAGTAATGGATGGGATACAGATTATGAGGTGATTGTTAGAAAGTATAGAGAG
AAAGGGTACGGAGAAGCTGTGCCGGAGATAGTGTTTTGGAATCTGAGGGATTCGAGGTCAACGCCTGTGCTTGGAAACAA
GAAAGGAGTGGCTTTGGTAAGTGGGTTTTCCCAGAACTTGATCAAAGTGTTTTTGGAACACGATGGAGAGATTGGTGATG
GAGATGTTGATAATGGAGAGATTGATCCCATGATGATCATGGAGGCTGCTATATCTAAAGATGAGTATAAGTCGCTTGTT
GTAATTGATTGA