Details for Lyrate rockcress Locus 16043013

Position : sca5 ( 5`- 18013556 .. 18011525 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_324178 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16043013

Protein [Map View]
MAEPVLEDTYLTFSSDFDSITIPPSSFDNFCNSSSDQVGNSISDLRFLIDDDDGDGDFQFTSEDDLYFPPKNESFAIPVD
AREMSGDFTPASELSGDCVKEETEKNTNGVLISTPIYCDRESPGDSDRSGTTQSLSLSAQESAKRKKEIQEDSREESRNN
KYRTLDQDGFASVVTGGDEEDDEKKKVRLIRNRESAHLSRQRKKHYVEELEDKVKNMHSTISELSSKMSYFMAENVTLRQ
QMGPRNGMCQPSMYPPLAPMAYPWIPYPAYMVKPQGSQVPLLPIPRLKPQHSVAKVKKFKKVASVSVLGLLFCLFLFCAL
APIVNISYGEYKSNYGVYDQSRGRVLVVDSNRAHCGGDSDQGVRRNVSETGNLGPPRNSSEPLVASLFVPRNEKLVKIDG
NLIIHSVLASEKARDSETKNKEGKSGVATTTKGIISPAMPLPDSTRTMDMSKHLYSETPKALSSSGSDDALKEQLKLTTA
NGQMQQWFREGVAGPMFSSGMCTEVFQFDVSSTSGSIMPASPPTEQSKNTDTHKGKKNRRILHGGLSASDFNLTKDHKCS
SKENFQDTKPAPSMVVSVLVDPREGGDGDIDEMMGGTKSLSPVFIVLLVDDVKYVTYSCILPRPEVPHLVST*

DNA
ATGGCGGAACCTGTTTTGGAGGACACTTATCTTACCTTCTCTTCCGATTTCGATTCCATCACGATCCCTCCTTCTTCGTT
TGACAATTTCTGCAATTCTAGCTCCGATCAAGTTGGGAACTCGATCTCTGATCTGAGGTTTTTGATCGATGACGACGACG
GGGACGGAGACTTCCAGTTTACTTCAGAAGACGATCTCTACTTCCCCCCTAAGAACGAATCTTTCGCCATTCCTGTTGAC
GCTCGAGAAATGTCCGGTGATTTTACGCCGGCGTCGGAACTTTCAGGCGATTGTGTTAAAGAAGAAACGGAGAAGAATAC
CAATGGCGTGTTAATATCTACTCCAATCTACTGCGATAGGGAATCGCCTGGGGATTCTGATCGTTCCGGTACTACTCAGA
GCTTGAGTTTATCGGCACAAGAGTCTGCGAAGAGGAAAAAAGAGATTCAAGAAGATTCACGTGAAGAATCTAGGAACAAT
AAGTACAGGACATTGGATCAAGATGGCTTTGCAAGTGTTGTCACAGGTGGTGATGAAGAAGATGATGAGAAGAAGAAAGT
GAGACTGATTAGAAACCGTGAAAGTGCTCACCTTTCAAGACAGAGGAAGAAACATTACGTGGAGGAGCTTGAAGATAAAG
TTAAGAACATGCACTCCACTATATCGGAATTGAGCAGTAAGATGTCTTATTTCATGGCTGAGAATGTTACTTTGAGGCAG
CAGATGGGCCCCAGAAATGGCATGTGTCAACCATCGATGTATCCACCGTTGGCTCCAATGGCTTATCCGTGGATACCGTA
TCCGGCTTATATGGTTAAACCGCAAGGTTCTCAAGTGCCTTTACTTCCTATTCCTCGGTTGAAACCACAACACTCTGTGG
CTAAGGTGAAGAAGTTCAAGAAGGTTGCTAGTGTTAGTGTTCTTGGTCTTCTGTTTTGTCTATTTCTGTTTTGTGCATTG
GCTCCCATTGTGAACATTAGCTATGGCGAGTATAAGTCTAACTACGGGGTTTATGATCAGTCTAGAGGAAGAGTTTTGGT
TGTTGATAGTAATAGAGCACATTGTGGGGGAGATTCTGATCAAGGAGTGAGAAGAAACGTATCTGAGACAGGGAACTTGG
GGCCTCCTCGAAATAGTAGTGAACCTCTAGTTGCATCGCTATTTGTCCCGAGGAATGAAAAGCTTGTCAAGATCGATGGA
AATTTGATTATTCATTCTGTTTTGGCGAGCGAGAAAGCCAGGGATTCTGAAACAAAGAACAAAGAAGGCAAAAGCGGTGT
AGCAACTACTACTAAAGGGATTATTTCTCCTGCAATGCCTTTACCTGACTCCACAAGGACCATGGATATGTCTAAGCACC
TCTATAGCGAAACGCCGAAAGCCCTGTCATCTTCTGGTTCTGATGATGCTTTGAAAGAACAACTCAAATTAACAACAGCC
AATGGTCAAATGCAGCAATGGTTTCGTGAAGGTGTTGCAGGGCCAATGTTCAGTTCGGGGATGTGCACCGAAGTGTTTCA
GTTTGATGTCTCCTCAACCTCAGGATCCATCATGCCTGCTTCTCCACCTACTGAACAATCTAAGAACACTGATACTCACA
AGGGGAAAAAGAACAGAAGAATCCTCCATGGTGGTCTTTCAGCATCTGATTTTAATCTTACCAAAGATCATAAGTGCTCT
AGCAAAGAGAACTTCCAGGACACCAAGCCTGCCCCGTCAATGGTTGTATCTGTGCTTGTTGATCCCAGAGAAGGCGGGGA
TGGAGACATCGATGAGATGATGGGAGGAACAAAATCACTGTCTCCAGTTTTCATAGTCTTGCTTGTGGACGATGTGAAGT
ATGTAACATACTCCTGCATTCTTCCACGGCCAGAAGTCCCTCATCTCGTGAGCACTTGA