Details for Lyrate rockcress Locus 16043009

Position : sca3 ( 5`- 6868250 .. 6866707 -3` )
Annotation : [B2G] mitotic phosphoprotein n
External links : CoGe
PGDD synteny : 16043009

Protein [Map View]
MSAAAHRTPKSGRQSLLFQDLASPVSARRGKFSSPGQAAAVSALWRENFGGSDLPPPPMYTLDDRSDFSPESGIADYSAS
PDAKSDRRMPFQSSGKNIVTPGKGKLEASPSFSLLNAQQSQQISGSPSWWSQSKAGSSTEQDDKGKGSPVEGVVQPGALV
TLPPPREVARPEVQRQIIPTGNLDEEEWVTVYGFSPGDTNLVLREFEKCGMVLKHVPGPRNANWMHILYQNRSDAHKALN
KAGMMINGVVIVGVKPVDPIQKQALNERLNNQGFVPLPPPSSTRDTARPLSRPQYLQNGSAFSPQPSGGAMASPSKSMVS
KFFDLMFGV*

DNA
ATGAGTGCTGCAGCTCACAGGACTCCTAAATCAGGGAGGCAATCTTTGCTATTTCAAGATTTAGCTTCTCCTGTTTCAGC
ACGTAGAGGGAAATTCTCGAGTCCAGGACAGGCAGCTGCGGTATCTGCACTATGGCGTGAAAATTTCGGAGGATCGGATC
TTCCACCACCTCCAATGTATACTTTAGATGACCGGTCGGATTTCTCCCCTGAGTCTGGCATTGCAGACTACTCTGCTTCT
CCAGATGCTAAATCTGACAGAAGAATGCCTTTCCAGAGTTCTGGAAAGAATATTGTAACTCCCGGTAAAGGAAAGTTGGA
AGCAAGCCCGTCTTTTTCTCTACTGAATGCACAACAGAGTCAGCAAATTTCAGGGAGTCCGAGTTGGTGGTCGCAGTCAA
AGGCAGGTAGTAGTACCGAGCAGGATGATAAAGGGAAGGGTTCTCCTGTAGAAGGGGTGGTTCAGCCAGGTGCATTGGTC
ACTCTTCCGCCGCCAAGAGAAGTTGCTAGGCCAGAGGTTCAGAGGCAGATTATACCTACAGGAAACCTTGATGAGGAAGA
ATGGGTCACTGTCTATGGATTTTCTCCAGGTGATACAAATTTGGTACTACGGGAATTTGAAAAGTGTGGTATGGTCTTGA
AACATGTTCCTGGTCCAAGGAATGCCAACTGGATGCACATCCTCTACCAGAACCGGTCTGATGCACATAAGGCGCTGAAC
AAAGCCGGGATGATGATAAACGGAGTGGTTATAGTAGGAGTGAAGCCAGTAGACCCTATACAGAAGCAAGCTTTAAACGA
GAGACTCAACAACCAAGGATTCGTGCCTTTACCTCCACCATCATCCACTAGAGACACTGCTCGACCCTTGTCTCGTCCTC
AGTACTTGCAAAATGGCAGCGCTTTCTCCCCTCAACCAAGTGGTGGCGCTATGGCCTCTCCGTCAAAGTCAATGGTCTCA
AAGTTCTTTGACTTGATGTTCGGTGTTTAA