Details for Lyrate rockcress Locus 16042858

Position : sca3 ( 5`- 22136313 .. 22133610 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042858

Protein [Map View]
MGGLLHLFDFHNNSFSRKVFSHHKSRDEDLEAPRNSFELQVDNFHTYHNEKDKPSNGFEEEEWYERSCYPIEESMKKKII
EELSKRSNDKQNTPSLVAKLMGMDALPLESAKSSAWIYPRQSKVNRFDDEKGGRRKSRKGRLSSSVTALDVMETPIRREH
PQEEELQRFRREFEAWQADKRFQDCSRIVDSGRVVARDEKERLFTRTRSFGRDFILKSDRTAPTRIVVLRPGLQRAYDYE
DSLTTSSGTTMEGSRGSSIEEFLEEVKERLKGELQGKAALKRSSSVRGSGIETPFSERPSPRSESMRSYAVSEVQCNAPD
SPTEFISRDTRKLLADRLKNVLRKEMTPSDDSVVKCSSRLRPTVSDAAKQAEEINQEDSRINGDVSKKDSLSPRNLKRSL
SAPVSGTSFGKLLLEDRHVLTGAQIMRKHEATITEREETEPVVVDPIRRKERFNLRKKVSSFRSTLRGRIFGKKIRSMIE
SNSFEDESIKDFVTGSKFNNFYDRNENSTEVPPSPASVCSSTPEEFWRNVDYLSQVSTPDVTVSDENGMPQVFRDISSNL
SELRRQINELESDVQVRTPVEEEPTQEIETIVDLGNPDKVFVRDLLVVSGLYEGTSDISLSRWDPLAKPIKRSVLEEAKE
NLKKRSNQNQEDEDTGENNTISEENHNILFDLLNEVLTVVLGPLTKSGFKNKLLSSSVSESTTIRGKYLLESTWRIMSEY
LYSQPEKPFCSLDGIIGWDMDRFPWSGLISEEVNVLGKEVEGMIMADLVEELVKDLRRQIC*

DNA
ATGGGAGGATTATTGCATCTCTTCGATTTCCACAACAACAGTTTCTCCCGGAAAGTTTTCTCTCATCACAAAAGCCGCGA
CGAAGATCTGGAAGCTCCAAGAAATAGTTTCGAGCTTCAAGTCGATAACTTTCATACATACCATAACGAGAAAGATAAAC
CGAGTAATGGATTTGAGGAAGAGGAATGGTACGAGAGAAGTTGTTACCCAATTGAGGAGTCAATGAAGAAGAAGATCATC
GAGGAGCTTTCGAAACGGTCCAACGATAAACAGAACACTCCGAGTCTTGTAGCTAAGTTGATGGGAATGGATGCACTTCC
TTTGGAGTCTGCTAAGTCATCGGCTTGGATCTATCCTCGTCAGAGTAAAGTGAATCGATTTGATGATGAGAAAGGAGGAA
GAAGAAAAAGTAGAAAAGGAAGGTTATCTTCATCGGTGACCGCATTGGATGTAATGGAGACACCAATCCGTAGAGAACAT
CCTCAAGAAGAGGAGCTACAAAGATTTAGAAGAGAGTTTGAAGCCTGGCAAGCTGATAAAAGGTTTCAAGATTGTTCAAG
AATCGTTGATTCGGGCCGCGTGGTGGCTCGGGATGAGAAAGAGAGGCTTTTCACGAGAACTAGGAGCTTTGGTAGGGATT
TTATCTTGAAATCTGATAGGACTGCTCCAACTAGGATTGTGGTTCTGAGACCTGGTCTTCAGAGAGCGTATGATTACGAA
GATTCGTTGACTACTTCTTCAGGGACGACCATGGAAGGAAGCAGAGGAAGTAGCATAGAAGAGTTTCTTGAGGAAGTTAA
AGAGAGATTAAAAGGTGAGCTTCAAGGAAAAGCAGCTCTCAAGAGAAGTTCATCAGTGAGAGGAAGCGGTATCGAGACTC
CTTTCAGCGAAAGACCTTCTCCGAGGTCTGAATCGATGAGATCATATGCAGTGAGTGAGGTTCAGTGCAATGCACCAGAC
TCTCCTACTGAGTTTATAAGTAGAGATACTAGAAAACTTTTGGCAGACAGATTGAAGAATGTTTTGAGAAAAGAGATGAC
TCCTTCAGATGATTCTGTGGTCAAATGTAGTAGCCGTTTGCGACCTACTGTGTCGGATGCAGCGAAACAAGCTGAGGAAA
TTAATCAAGAAGACTCGAGAATAAATGGAGATGTTTCTAAGAAAGATTCTTTATCACCAAGAAATCTCAAAAGATCATTA
TCTGCTCCTGTCTCAGGAACATCATTTGGTAAGCTTCTGTTAGAGGACCGGCATGTTTTGACTGGCGCGCAGATCATGAG
AAAGCACGAGGCTACGATAACAGAGCGAGAAGAAACAGAACCAGTTGTTGTGGATCCTATCCGGAGGAAAGAAAGATTCA
ATCTTAGGAAGAAAGTTTCCAGCTTTAGATCAACTCTTAGAGGAAGAATCTTTGGTAAGAAGATACGTTCAATGATCGAG
TCAAACAGTTTCGAGGATGAATCAATCAAAGATTTCGTGACGGGATCGAAGTTTAACAACTTTTACGATCGAAATGAGAA
TTCAACAGAAGTGCCTCCAAGCCCTGCATCAGTCTGCAGCAGTACACCAGAAGAGTTCTGGAGGAATGTCGATTATCTCA
GCCAGGTTTCGACACCCGATGTGACTGTATCGGATGAGAATGGTATGCCTCAAGTCTTCAGAGACATCAGTTCTAATCTA
AGTGAACTAAGAAGACAGATAAATGAGCTTGAGTCCGATGTACAAGTGAGAACGCCTGTGGAAGAAGAACCAACTCAAGA
GATTGAGACCATAGTTGATTTAGGAAATCCAGACAAAGTATTTGTGAGAGATCTTCTTGTGGTTTCTGGTTTGTATGAAG
GGACATCAGATATATCATTGTCTAGATGGGATCCATTAGCAAAGCCTATAAAAAGGTCTGTTCTTGAAGAAGCAAAAGAG
AATCTCAAGAAAAGAAGCAATCAGAATCAAGAAGACGAAGATACCGGAGAGAATAATACTATAAGTGAAGAAAACCACAA
CATACTGTTTGATCTTCTGAATGAAGTACTTACAGTGGTGCTTGGACCATTGACAAAGTCAGGTTTCAAGAACAAACTTT
TGAGTTCATCGGTGTCTGAATCAACGACTATACGAGGTAAATATCTGTTGGAATCAACATGGAGGATCATGTCAGAGTAT
TTATATTCTCAGCCAGAGAAACCTTTCTGTTCATTGGATGGGATCATTGGTTGGGACATGGATAGGTTTCCATGGAGTGG
TTTGATTAGTGAAGAAGTTAATGTGTTGGGGAAAGAAGTTGAAGGTATGATCATGGCAGATCTTGTTGAGGAGCTTGTTA
AGGATCTAAGAAGACAAATATGCTAA