Details for Lyrate rockcress Locus 16042790

Position : sca3 ( 5`- 7335411 .. 7342766 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479191 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042790

Protein [Map View]
MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRRSMAIERSKVRHDFCETYGNN
CQNVDRHCFEPGSSFLRQFLFFFKAQNSGDFVILVETCRLLQSFVDSSGDIVSLFSGLDYSSKHNLVDFRVKKLAFTCIE
AIHQNRNRLRDQLLVTPEEASISTAILMEAVSLLLDPKLPWVCKIVSYLHKENVFKLVREMVTTAKESSRGQTMTGSILS
LERVLTLIVPHIGREPCCCPVVDPRCSFSSMILTIPLIWKLFPNLKVVFANPSLSQHYIHQMASCIQKDTCVLPMETSPE
FPGYACLLGNTLDTANVVLSQPECSLDMAIDIALVATFLLETLPPVKSSEKESRQSSSDEDDMLIDDVPELVLNRALEHQ
ITNAIDSRFLLQLTNVLFHQVSLGTQSYDEDKEALAIGTASSFLYAAFNTLPLERIMTILAYRTELVAVLWNYMKRCHEN
QKWSSMPKLLAYLPGDAPGWLLPLVVFCPVYKHMLMIVDNEEFYEREKPLSLQDIRLLIIILKQALWQLLWVNPLTQPNT
GKSVSNDLSKKNPVELIQNRVGVVVSELLSQLQDWNNRQQFTSSSDFQADTVNEYFISQAIVEGTRANYILMQAPFLIPF
TSRVKIFTTQLATARQSHGSQGIFARNRFRIRRDHILEDAYNQMSALSEDDLRGSIRVTFVNELGVEEAGIDGGGIFKDF
MEKITRAAFDVQYGLFKETADHMLYPNPGSGMIHDQHLQFFHFLGSLLAKAMFEGILVDIPFATFFLSKLKQKYNYLNDL
PSLDPELYRHLIFLKRYKGDISDLELYFVILNNEYGERTEEELLPGGQDMRVTNENVITFIHLVSNHRLNFQIRQQSSHF
LRGFQQLIPKEWIDMFNEHELQVLISGSVDSLDIDDLRNNTNYAGGYHAGHYVIDMFWEVMKSFSTENQKKFLKFVTGCS
RGPLLGFKYLEPAFCIQRAAGSASNESVDRLPTSATCMNLLKLPPYQSKELLETKLMYAISAEAGFDLS*

DNA
ATGTTTTTCTCCGGCGATCCGTCGACTCGGAAGCGAGTTGATTTAGGTGGCCGGAGCACCAAGGAAAGAGATGCTCGGAA
GCTTCTGGAGCAGACTAGAATGGAGCGTAATCGTCGCTTGCTACAGAAGCAGCAGAACTCTGCTGCTCTCAAAATTCAGA
AATTCTTTAGAGGTCGACGATCAATGGCCATTGAGCGCTCGAAGGTGCGGCATGATTTCTGTGAAACCTATGGGAATAAT
TGCCAGAATGTCGATAGACATTGCTTTGAGCCAGGCTCAAGTTTCCTCCGGCAGTTTCTGTTTTTTTTCAAGGCACAAAA
CTCGGGAGATTTTGTGATACTTGTGGAGACTTGTCGTCTACTGCAGAGTTTCGTTGACAGCAGTGGTGACATTGTCAGCC
TTTTTTCTGGCTTGGACTATTCCTCTAAGCATAATTTGGTGGATTTTAGAGTAAAGAAACTTGCATTTACCTGTATTGAA
GCTATACACCAGAATAGGAACCGTTTAAGGGATCAGCTCTTAGTTACTCCTGAAGAAGCTAGCATTTCAACAGCTATCTT
GATGGAGGCAGTGTCGTTGTTGCTAGATCCTAAGCTGCCTTGGGTCTGCAAAATAGTTAGTTATCTACATAAAGAGAACG
TATTCAAACTGGTGCGAGAAATGGTCACTACGGCTAAGGAAAGCTCAAGAGGTCAGACAATGACCGGCAGCATCCTTTCA
CTAGAAAGAGTCTTGACACTGATAGTACCACATATTGGCCGTGAGCCATGTTGCTGCCCTGTTGTTGATCCACGTTGTAG
TTTCTCATCTATGATTCTTACAATACCTTTGATATGGAAGCTCTTCCCAAACTTGAAAGTGGTCTTTGCCAACCCAAGTC
TAAGTCAACACTACATTCACCAGATGGCTTCCTGTATTCAAAAGGATACCTGTGTTCTCCCAATGGAAACAAGCCCAGAA
TTCCCTGGTTATGCTTGCCTGCTTGGTAATACGTTGGACACTGCAAATGTGGTGTTGTCACAGCCTGAATGTTCATTAGA
CATGGCAATTGACATTGCATTAGTTGCAACTTTCTTATTGGAGACACTTCCTCCTGTGAAATCATCAGAAAAAGAAAGCA
GACAGAGCTCTTCTGATGAGGATGATATGCTAATTGACGATGTACCAGAATTAGTCTTGAATAGGGCACTTGAGCACCAG
ATAACCAATGCTATAGACTCACGTTTTCTTCTGCAGTTAACAAATGTTTTGTTCCATCAAGTTTCGCTTGGTACGCAGTC
ATATGACGAAGATAAAGAAGCATTAGCTATTGGCACAGCCAGTTCTTTTCTGTATGCAGCATTCAACACTCTCCCTCTTG
AGCGGATCATGACAATTTTGGCTTATAGGACCGAGCTTGTAGCTGTGTTGTGGAATTATATGAAACGATGCCATGAGAAC
CAGAAGTGGTCATCCATGCCTAAACTCCTAGCTTACCTTCCAGGGGATGCTCCGGGTTGGCTATTACCTCTGGTTGTTTT
TTGTCCTGTTTATAAGCATATGCTTATGATAGTCGACAATGAGGAGTTTTATGAACGAGAGAAGCCATTATCGCTACAAG
ATATCAGGTTGCTCATCATTATTCTTAAGCAAGCTTTATGGCAGTTATTATGGGTAAATCCACTTACGCAACCTAACACT
GGGAAATCTGTCTCCAATGACCTCTCGAAGAAGAACCCTGTTGAATTGATTCAGAACAGGGTTGGGGTTGTAGTCTCTGA
GTTACTTTCACAGCTGCAAGATTGGAACAACCGGCAACAATTCACTTCCTCGAGTGACTTCCAAGCTGATACAGTCAATG
AATATTTCATCTCTCAGGCCATAGTGGAAGGAACGAGAGCCAACTACATACTGATGCAAGCTCCGTTCTTGATTCCGTTT
ACAAGCAGAGTCAAAATATTCACAACACAATTAGCAACGGCAAGGCAGAGTCATGGATCGCAAGGAATTTTTGCTCGAAA
TCGGTTCAGAATACGAAGAGATCATATCTTGGAAGATGCTTACAATCAAATGAGTGCGTTGTCAGAGGATGATCTCCGGG
GGTCGATTCGCGTGACATTTGTCAATGAACTCGGAGTTGAGGAAGCTGGTATTGATGGTGGTGGCATTTTCAAAGACTTC
ATGGAGAAAATTACCCGAGCTGCCTTTGATGTGCAATACGGGTTGTTTAAGGAGACGGCTGATCATATGCTTTATCCTAA
TCCTGGGTCAGGAATGATACATGACCAGCATCTCCAGTTCTTTCATTTTCTCGGCAGTCTTCTTGCAAAAGCAATGTTTG
AAGGGATTCTAGTTGATATACCATTTGCAACGTTTTTCCTCAGCAAACTGAAACAAAAGTACAACTATTTGAACGATTTG
CCTTCTCTGGATCCTGAGTTGTATAGGCACCTTATATTTCTGAAGCGTTATAAGGGTGATATCTCAGATTTGGAGCTTTA
CTTTGTTATTTTGAATAATGAATATGGAGAGAGGACAGAGGAAGAGCTACTTCCAGGGGGACAAGACATGCGAGTTACAA
ATGAGAATGTTATAACTTTCATTCATCTGGTTTCCAATCATCGGTTAAATTTTCAGATACGCCAGCAGAGTTCTCATTTC
TTGAGGGGGTTTCAGCAACTCATTCCAAAAGAATGGATCGACATGTTCAATGAGCATGAGCTTCAGGTTCTCATATCTGG
TTCAGTTGACAGTTTGGATATTGACGACTTGCGAAACAACACTAATTATGCTGGAGGCTACCACGCGGGACATTATGTGA
TCGATATGTTCTGGGAAGTTATGAAAAGCTTCTCAACTGAAAACCAGAAGAAGTTCTTAAAGTTTGTGACGGGCTGTTCT
CGAGGACCACTGCTCGGTTTCAAATACTTGGAACCTGCATTCTGCATACAGAGGGCTGCCGGTAGTGCGAGTAATGAATC
AGTTGATAGACTACCTACATCAGCCACTTGTATGAATCTTCTTAAGCTTCCGCCTTATCAAAGCAAAGAGCTACTTGAGA
CGAAGTTGATGTACGCCATAAGCGCAGAAGCGGGTTTTGATCTGAGCTGA