Details for Lyrate rockcress Locus 16042779

Position : sca3 ( 5`- 7047084 .. 7045117 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042779

Protein [Map View]
MFLRLLESCIRSRNLILGQIIHQHLLKRSLTLSSSTVLVNLTRLYASCNEVELARHVFDEIPHPRINPIAWDLMIRAYVS
NGFAEKALDLYYKMLNSGVRPTKFTYPFVLKACAGLRAIEDGKLIHSHVKCSNFAADMYVCTALVDFYAKCGELDMAIKV
FDEMPKRDIVAWNAMISGFSLHCCLTDVIGLFLDMRRSDCLSPNLSTIVGMFPALGRAGALREGKAVHGYCTRMGFSNDL
VVKTGILDVYAKSKCIIYARRVFDSDFKKNEVTWSAMIGGYVENEMIKEAGEVFLQMLVNADMAMVTPVAIGLILMGCAR
FGDLSGGRCVHCYAIKAGFILDLTVGNTVISFYAKYGSLCDAFRQFTEIGLKDIVSYNSLISGCVENCRAEESFRLFHQM
KSSGIRPDITTLLGILTACSNLAALGHGSSCHGYCVVNGYAVNTSICNALMDMYTKCGKLYVAKRVFDTMHKRDIVSWNT
MLFGFGIHGLGKEALSLFNSMQDTGVHPDEVTLLAILSACSHSGLVDEGKQLFNSMSRGDFNVIPRLDHYNCMTDLLARA
GYLDEAYDFVNKMPFEPDIRVLGTLLSACWTYKNVELGNEVSKKMQSLGETTESLVLLSNTYSAAERWEDAAKIRMTQKK
SGLLKTPGYSWVDVD*

DNA
ATGTTTCTGAGACTTCTTGAATCCTGTATTCGATCAAGGAATCTGATCTTAGGTCAGATTATTCATCAGCATCTTCTTAA
GCGCTCTCTTACGTTGAGTTCCTCTACCGTGCTTGTCAATTTAACGCGTCTCTATGCATCATGCAATGAAGTGGAACTTG
CACGCCATGTGTTCGATGAAATTCCTCATCCAAGGATCAATCCTATTGCGTGGGACTTGATGATCAGAGCCTATGTATCT
AATGGTTTCGCGGAAAAAGCTTTGGATTTGTACTACAAGATGCTGAATTCTGGTGTTAGACCCACGAAATTTACGTACCC
GTTTGTTCTGAAAGCATGTGCTGGTCTTCGAGCAATTGAAGATGGTAAGCTGATACATAGCCATGTGAAATGTAGCAACT
TTGCAGCTGATATGTATGTATGTACTGCTCTGGTTGATTTTTATGCTAAATGTGGGGAGCTCGATATGGCTATAAAGGTG
TTCGACGAAATGCCTAAGAGAGATATTGTCGCTTGGAATGCTATGATTTCTGGGTTTTCTTTACATTGTTGTTTAACTGA
TGTCATTGGATTGTTTTTGGATATGCGTAGAAGCGATTGTCTCAGCCCTAATTTATCCACTATTGTTGGGATGTTTCCTG
CACTAGGAAGGGCTGGTGCTTTGAGGGAAGGGAAAGCGGTTCATGGGTATTGCACACGAATGGGTTTTAGCAATGATTTA
GTTGTTAAGACTGGGATCTTGGATGTATATGCCAAAAGCAAGTGCATTATCTATGCGAGAAGAGTTTTCGATTCAGACTT
TAAGAAGAATGAGGTAACCTGGAGTGCTATGATTGGAGGCTACGTAGAAAACGAAATGATAAAGGAAGCTGGAGAAGTGT
TTTTGCAGATGTTGGTTAATGCAGATATGGCGATGGTGACACCAGTGGCCATTGGGCTTATTCTGATGGGTTGTGCGAGG
TTTGGAGATCTGAGTGGAGGGCGATGCGTACATTGTTACGCGATTAAAGCAGGCTTCATCTTAGACTTAACTGTTGGAAA
CACCGTAATTTCATTCTACGCCAAGTATGGAAGCTTATGTGATGCTTTTAGGCAGTTTACTGAGATTGGCTTGAAAGACA
TTGTTTCATATAATTCTCTTATCTCTGGGTGTGTGGAGAACTGTCGTGCAGAAGAGAGTTTTCGTCTATTTCATCAGATG
AAATCATCCGGAATTCGGCCCGATATTACAACATTGCTTGGTATCTTAACCGCTTGCTCTAACTTGGCTGCTTTGGGACA
CGGTTCTAGTTGCCATGGGTATTGTGTTGTTAATGGTTATGCAGTTAACACAAGCATTTGTAATGCACTGATGGATATGT
ACACAAAGTGTGGAAAACTTTATGTAGCCAAGAGAGTTTTCGACACAATGCATAAGCGGGATATAGTTTCGTGGAACACA
ATGCTGTTTGGATTTGGAATCCATGGGCTTGGCAAAGAAGCTCTTTCTCTGTTCAACAGTATGCAGGACACAGGTGTGCA
CCCAGACGAGGTGACTCTTCTTGCGATTTTGTCTGCATGTAGCCATTCAGGACTTGTAGATGAAGGGAAACAACTGTTCA
ACTCTATGTCTCGAGGAGATTTCAACGTCATACCAAGATTAGACCATTACAATTGCATGACTGATCTCCTAGCCCGTGCC
GGATACTTGGATGAAGCTTATGATTTCGTCAACAAGATGCCATTTGAGCCCGATATTCGCGTGTTGGGTACACTTCTATC
TGCTTGTTGGACGTACAAGAATGTGGAACTTGGGAATGAAGTGTCGAAAAAGATGCAGAGTCTTGGAGAAACAACAGAAA
GCTTAGTTCTTCTATCCAACACCTATTCAGCTGCTGAGAGATGGGAAGATGCAGCAAAAATTAGAATGACACAGAAGAAG
AGCGGGCTTCTCAAGACTCCCGGCTATAGCTGGGTCGATGTGGATTAA