Details for Lyrate rockcress Locus 16042771

Position : sca3 ( 5`- 6209459 .. 6207214 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042771

Protein [Map View]
MGKSQILLLAESFTCSLKTLFTLWIVFTFPFQAQAAPSGSLIKHMSWVLKWTTGSSSKISQSDTNVLQFENGYLVETVVE
GNEIGVVPYKIRVSHDGELYAVDELNSNIMKITPPLSQYSRGRLVAGSFQGKTGHADGKPSEARFNHPRGVTMDDKGNVY
VGDTLNLAIRKIGDSGVTTIAGGKSNIAGYRDGPSEDAKFSNDFDVVYVRSTCSLLVIDRGNAALRQISLSDEDCDYQDD
SSISLTDILLVIGAVLIGYATCLLQQGFGNSFFSKTQLESETSFEEEHPGKEKLSLPVHETKVTKEEPGWPSFGQLIIDL
CKLALDFITSHLVPTRFTTSHNLRPLKDRLKMPEDEQEPPRVQRHTAPAPISESRHAHLPKADDSYPEHKTPKLRSSSVM
KDPALSASKHHRSSSKRQDYAQFYASGEVAPPKIHKERSRRRHRDKTTETEPKLTPSDTVKPVEYSNSSKFDHYNMRSSK
YGPETPFRF*

DNA
ATGGGCAAATCTCAGATTCTTCTACTCGCTGAGAGCTTTACTTGTTCTCTAAAGACTTTGTTCACTTTATGGATCGTCTT
CACCTTTCCATTTCAAGCTCAAGCTGCTCCTTCTGGTTCTTTGATTAAACACATGTCCTGGGTTCTCAAGTGGACTACTG
GATCATCCTCTAAAATATCCCAATCAGACACTAATGTTCTTCAGTTTGAGAATGGTTACTTGGTCGAAACTGTTGTCGAA
GGAAACGAAATCGGTGTTGTTCCTTACAAGATTCGAGTTTCTCATGATGGTGAACTTTATGCTGTTGATGAACTTAATAG
CAACATCATGAAAATCACTCCTCCCTTGTCCCAGTACAGCAGGGGAAGGTTGGTGGCTGGATCGTTTCAAGGAAAGACGG
GACATGCAGATGGAAAGCCAAGCGAGGCTCGTTTTAATCATCCGAGAGGTGTAACCATGGATGACAAAGGGAACGTTTAT
GTCGGTGATACGTTGAATCTCGCTATCCGAAAGATTGGAGATTCAGGTGTTACTACGATAGCTGGAGGGAAATCTAATAT
TGCTGGGTATAGAGATGGACCAAGTGAGGATGCAAAGTTCTCAAATGATTTTGATGTCGTATATGTTCGGTCTACCTGCT
CGCTGCTGGTCATTGACAGAGGAAATGCGGCTCTTCGCCAAATCTCTCTCAGCGATGAGGACTGTGACTATCAAGATGAT
AGCTCCATCTCTCTAACTGATATACTCTTGGTTATTGGTGCTGTTCTCATTGGTTATGCTACTTGTTTGCTCCAGCAGGG
TTTTGGAAATTCTTTCTTCTCAAAGACGCAGCTAGAATCAGAAACCAGCTTTGAAGAGGAGCACCCAGGCAAAGAGAAAC
TCTCCCTACCTGTCCATGAGACAAAAGTAACCAAGGAAGAACCTGGTTGGCCATCGTTTGGGCAACTCATTATTGATCTC
TGCAAACTCGCTCTCGATTTTATAACCAGCCACCTAGTTCCAACCCGATTCACAACCAGCCATAATCTAAGGCCATTAAA
AGATAGACTCAAAATGCCTGAAGACGAACAAGAACCACCTCGAGTCCAAAGGCATACTGCCCCAGCACCAATCTCTGAAT
CGCGACATGCCCACTTGCCTAAAGCTGATGATAGTTACCCGGAACATAAGACCCCAAAGCTAAGATCAAGTAGTGTAATG
AAGGACCCTGCTTTGTCAGCATCCAAGCACCACCGGTCATCATCAAAACGGCAGGACTATGCTCAGTTCTATGCCTCAGG
AGAGGTTGCCCCACCGAAGATCCATAAAGAGCGATCAAGGCGTCGCCATAGAGATAAAACAACCGAAACAGAACCAAAGC
TAACACCATCAGATACGGTGAAGCCTGTAGAGTACAGTAATAGTTCAAAGTTTGATCATTACAACATGAGGAGCAGCAAG
TATGGACCTGAAACTCCATTTCGATTCTAG