Details for Lyrate rockcress Locus 16042765

Position : sca3 ( 5`- 12297069 .. 12295677 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042765

Protein [Map View]
MNIASRIRRSFFREKKEYSDGNILKNGSSVKEEGKDEILGVTDELIDHVRSFTIDTFKNFSLEDEEEEVSVSHLGDDDNG
MSSSVNVKKDLSDWQEKHAVLVLSKSKELSQLRFKLCPRVLKEHQFWRIYFQLVRKLVAKYEVLAIQQAKIRRMAMEDSK
TSETKGVYEVEMSKTKQRLSTGPATP*

DNA
ATGAATATAGCTTCGAGGATTCGACGAAGTTTTTTCAGAGAGAAGAAGGAATATTCCGATGGGAATATCTTGAAGAATGG
ATCGAGTGTTAAGGAAGAAGGTAAAGATGAGATTTTGGGAGTTACTGATGAATTAATCGATCATGTCAGATCTTTCACCA
TTGATACGTTTAAGAACTTTTCTCTTGAAGATGAAGAAGAAGAAGTATCTGTGAGTCATTTGGGAGATGACGATAATGGA
ATGAGTTCGTCTGTGAATGTGAAGAAGGATTTATCTGATTGGCAGGAGAAACACGCGGTTCTTGTCTTATCGAAATCTAA
GGAACTCTCACAGCTGAGATTCAAGTTATGCCCGCGAGTTTTAAAGGAACATCAGTTTTGGAGGATATATTTCCAGCTTG
TGAGGAAGCTTGTGGCAAAGTATGAGGTGCTAGCAATCCAACAGGCTAAAATAAGGAGGATGGCCATGGAAGACAGTAAA
ACTTCTGAAACCAAGGGTGTATATGAAGTTGAAATGTCAAAAACAAAACAAAGGTTGAGTACAGGACCGGCAACTCCGTG
A