Details for Lyrate rockcress Locus 16042756

Position : sca3 ( 5`- 8348841 .. 8350290 -3` )
Annotation : [B2G] zinc finger (ccch-type) family protein
External links : CoGe
PGDD synteny : 16042756

Protein [Map View]
MDSSYSDSRPMFVQSPYGGWNQTQMIDSMANPTNNEQGDLHSLSESQSQSQSQPPQQLQPALKRPRLVDDNVFNPASSFP
QPSSSNPWMVPSLNPPPVNKGTANIFYKTRMCAKFRAGTCRNGELCNFAHGIEDLRQPPSNWQEIVGPPPGQDREKERER
ERERERERPSLAPVANNNWEDDQKIILRMKLCRKFCFGEECPYGDRCNFIHEDLSKFREDSGKLRESSVISVGTSAADPP
SDTASNHIEVNRQGSIPVPAPMNNGGVVKTVYWKTRLCMKFDITGQCPFGDKCHFAHGQTELHNSVGRVDGEAVNATASV
SKQTVVPANEAFAMKPTTQVTADSSGLNEEGRRKKCLLKWSDSKKINRIYGDWIDDLPVGQKSSKPVES*

DNA
ATGGATTCGAGTTACTCTGATTCTCGTCCCATGTTCGTGCAATCACCTTATGGTGGTTGGAATCAAACCCAGATGATTGA
TTCAATGGCTAATCCAACGAACAACGAGCAAGGAGACTTGCATTCACTATCTGAATCACAGTCACAGTCACAATCTCAAC
CGCCTCAGCAGTTACAGCCTGCATTGAAAAGGCCAAGACTTGTTGATGATAACGTGTTTAATCCGGCTTCATCGTTTCCT
CAGCCTTCGAGTAGTAATCCTTGGATGGTTCCGTCGTTAAACCCTCCTCCTGTGAACAAAGGGACGGCTAATATATTCTA
TAAGACTAGAATGTGTGCGAAATTCAGGGCCGGGACTTGTAGGAATGGTGAACTCTGTAATTTTGCTCATGGGATCGAGG
ATTTGAGGCAGCCTCCGTCGAATTGGCAGGAAATTGTTGGACCTCCTCCTGGTCAAGATAGGGAGAAGGAAAGGGAGAGG
GAAAGGGAGAGGGAGAGGGAGAGACCGTCTTTGGCGCCTGTTGCGAATAATAATTGGGAAGATGATCAAAAGATAATCTT
GAGGATGAAGCTTTGCAGGAAGTTTTGTTTTGGGGAAGAGTGTCCTTATGGGGACAGGTGCAATTTCATTCATGAGGATC
TGTCAAAGTTTCGTGAGGACTCGGGGAAATTGAGAGAGAGCTCAGTTATAAGTGTTGGTACTTCTGCTGCTGATCCACCA
TCTGATACTGCCTCGAATCATATTGAAGTTAATAGACAAGGAAGCATCCCGGTACCTGCACCTATGAACAATGGTGGTGT
TGTCAAGACTGTGTACTGGAAGACGAGGTTGTGCATGAAGTTTGACATCACGGGTCAATGCCCTTTTGGCGATAAGTGTC
ACTTTGCTCATGGCCAAACAGAGTTGCATAACTCTGTTGGAAGGGTTGATGGAGAAGCTGTGAACGCTACCGCGTCTGTG
AGTAAACAAACCGTGGTACCTGCGAATGAAGCATTTGCGATGAAACCAACTACACAAGTAACAGCAGATTCTTCTGGTCT
GAACGAAGAAGGGCGGCGAAAGAAGTGTCTGCTCAAGTGGAGCGACTCTAAGAAGATTAACCGAATCTATGGAGACTGGA
TCGATGATTTACCGGTGGGTCAAAAGTCGTCAAAGCCAGTAGAGAGCTGA