Details for Lyrate rockcress Locus 16042750

Position : sca3 ( 5`- 3044391 .. 3045744 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042750

Protein [Map View]
MATAVGGGSDVEVGFAKLQGEDFEYYMQSYSIILGRNSKKATVDVDLSSLGGGMNISRNHARIFYDFTRRRFSLEVLGKN
GCLVEGVLHLPGNPNVKLDSQDLLQIGDKEFYFLLPVRSILGGPLGPRHHVSGQTSVVPYHNYQSGPGSGSGKKGVRSRE
LYEYDDEDDDEDDDGEDIRGSGKKTRRDGHEVYASGEKKREGRSKVDREADDQQVLQLEEKDVVSSVATVLSDLCGPGDW
MPMEKLHAVILKEYGNVWHHSRVRRYLTQEDWAIPEAKGKPWYGLLMLLRKYPVHFVINTRSKGRVTLEFVSLVTLLT*

DNA
ATGGCTACGGCTGTTGGAGGCGGAAGCGATGTGGAGGTTGGATTTGCTAAGCTTCAAGGTGAGGATTTCGAGTACTATAT
GCAGTCGTACTCCATTATACTCGGCCGGAATTCTAAGAAAGCGACCGTCGACGTTGATCTCTCATCCCTCGGCGGCGGGA
TGAACATTTCGCGCAACCACGCTCGGATCTTCTATGACTTCACGCGACGCCGCTTCTCTCTCGAGGTCCTTGGCAAAAAT
GGTTGCCTCGTTGAAGGTGTCCTCCATCTCCCTGGGAATCCTAACGTCAAGCTCGATTCACAAGACCTTTTGCAGATTGG
TGACAAAGAGTTTTACTTTCTCCTTCCGGTTCGGAGCATTTTAGGTGGGCCATTGGGACCTAGGCATCACGTCTCAGGGC
AAACTAGTGTTGTTCCATACCATAATTATCAGTCAGGTCCGGGTTCTGGGTCGGGTAAAAAGGGTGTCAGGAGTAGAGAG
TTGTATGAGTACGATGATGAAGATGATGATGAAGATGACGATGGGGAGGATATCAGAGGCAGTGGAAAGAAAACAAGGAG
AGATGGACATGAAGTTTATGCTTCCGGAGAGAAGAAGAGAGAGGGAAGATCAAAGGTAGATCGTGAAGCTGATGATCAAC
AAGTTTTGCAGCTGGAGGAAAAAGATGTTGTATCATCTGTTGCCACTGTGCTTTCCGATTTGTGTGGTCCGGGAGACTGG
ATGCCTATGGAAAAACTTCATGCGGTGATATTAAAGGAGTATGGAAACGTATGGCATCACAGTCGAGTAAGAAGATACCT
AACACAAGAAGACTGGGCTATCCCTGAAGCAAAGGGTAAACCATGGTACGGTTTGCTGATGCTGCTGAGAAAATACCCGG
TGCATTTCGTCATCAACACTAGATCAAAGGGAAGGGTTACCCTTGAATTCGTTTCCCTCGTTACCCTACTCACATGA