Details for Lyrate rockcress Locus 16042744

Position : sca3 ( 5`- 7690404 .. 7688372 -3` )
Annotation : [B2G] wox1 protein
External links : CoGe
PGDD synteny : 16042744

Protein [Map View]
MWTMGYNEGGGDSFNGGRKLRPLIPRLSSCPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMVSSRWNPT
PDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKRRRQMEAGHEESVFSTTSLVSNHGF
DKKDPSGYKVEQSKNWICSIGCDTQPEKPSHDHHLEEPANIRVERNGRCGGDERRSVLGINATWQMMQLPPGFYPSPHHH
HQRNLILNSTTVSSNMSNSNITVSVAKDTVTISPVFLRTREAANTETCRRNCDDNKDQERDCSNGEPDHQEQTLELFPLR
KEGFCSDGEKEKEINSIHCFYEFLPMKN*

DNA
ATGTGGACGATGGGTTACAACGAAGGGGGCGGAGATTCCTTCAACGGAGGAAGAAAGCTTCGTCCTCTCATCCCACGCCT
CTCATCTTGTCCCACCGCCGCCGTAAACACCAACTCCGACCACCGCTTTAATATGGCAGTGGTGACGATGACGGCGGAGC
AGAACAAGAGGGAGCTGATGATGCTAAACTCAGAACCTCAACATCCACCGGTAATGGTGAGCTCACGGTGGAATCCGACG
CCAGATCAGTTAAGGGTTCTTGAAGAGCTTTACCGACAAGGAACTAGAACTCCTTCTGCCGACCACATCCAACAAATCAC
GGCACAACTACGACGGTACGGGAAGATAGAAGGCAAAAACGTTTTCTATTGGTTCCAAAACCACAAAGCCCGAGAACGCC
AGAAACGACGACGACAGATGGAAGCTGGTCATGAAGAATCGGTCTTTTCAACAACAAGTCTTGTCTCAAACCACGGATTC
GACAAGAAAGATCCGTCAGGTTACAAGGTTGAACAGTCCAAGAACTGGATATGTTCGATCGGATGCGACACACAACCAGA
GAAACCTTCCCATGATCATCATCTGGAGGAGCCAGCGAACATACGGGTCGAGCGCAATGGTCGTTGTGGAGGAGACGAGA
GACGAAGCGTTTTAGGGATAAACGCCACGTGGCAGATGATGCAGTTGCCACCTGGTTTCTACCCTTCTCCACATCATCAT
CATCAACGTAACCTCATTCTCAATTCAACTACTGTTTCCTCCAACATGTCCAATAGCAACATTACTGTTTCTGTTGCTAA
AGATACGGTCACGATTTCACCTGTATTTCTACGTACCAGAGAAGCAGCGAACACAGAGACTTGTCGTCGAAATTGTGATG
ATAATAAAGATCAAGAACGAGATTGCTCTAACGGTGAACCGGATCATCAAGAACAGACACTTGAGCTGTTTCCACTGAGA
AAAGAAGGGTTTTGTAGCGATGGTGAGAAAGAGAAGGAGATCAATAGTATTCACTGTTTCTATGAGTTTCTGCCTATGAA
GAACTAA