Details for Lyrate rockcress Locus 16042727

Position : sca3 ( 5`- 10365216 .. 10365001 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042727

Protein [Map View]
MVSSGIQPDDSTFKYLEVRTILMKLWNVENIVFVKSKKPEKKRLREGGLDLWISTLTSVLGIATTTSFKVS*

DNA
ATGGTTTCATCCGGAATTCAACCCGATGACTCAACGTTCAAATACTTGGAAGTTCGAACCATTCTGATGAAACTCTGGAA
TGTCGAAAACATAGTGTTCGTAAAATCGAAGAAGCCAGAAAAGAAGAGATTAAGAGAGGGAGGATTAGATCTATGGATCT
CAACACTCACATCTGTTCTTGGGATTGCAACGACGACGAGCTTTAAAGTTTCTTAA