Details for Lyrate rockcress Locus 16042726

Position : sca3 ( 5`- 7247847 .. 7247416 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042726

Protein [Map View]
MTICINVTISRAQNDIISPSSGFHNPRTTVVIYNDLGGHLPLRYHCKSKQDDLGDRTMAVNGTWSFEFRPSIFGRTLFFC
GFRWDNELHWFDIYTQKRDKEFTKFGCRRCEWKIHKDGPCKLNKNTKMFDVCLPWNSQLSENN*

DNA
ATGACTATTTGTATTAATGTAACAATATCTCGAGCCCAAAATGATATCATCAGTCCATCATCCGGTTTCCACAACCCAAG
AACAACAGTGGTGATATATAATGATCTTGGTGGTCATCTGCCATTGCGATATCATTGTAAATCAAAACAAGATGATCTTG
GAGACCGGACTATGGCGGTAAATGGAACGTGGTCATTTGAATTTAGACCCAGTATTTTTGGAAGAACTTTATTTTTTTGC
GGTTTTAGATGGGATAATGAGTTGCATTGGTTCGATATCTACACACAGAAGAGAGACAAAGAATTCACCAAGTTTGGATG
TAGAAGATGCGAATGGAAGATACACAAAGATGGACCTTGCAAACTTAACAAAAACACTAAAATGTTTGATGTTTGTCTTC
CTTGGAATTCTCAATTGTCTGAAAACAATTAA