Details for Lyrate rockcress Locus 16042711

Position : sca3 ( 5`- 774015 .. 772140 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477531 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042711

Protein [Map View]
MADNDSLDQFLAAAIDAAKNAGQVIRKGFYETKHVEHKGQVDLVTETDKGCEELVFNHLKQLFPNHKFIGEETTAAYGVT
ELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPLVGVVYNPIMDELFTGVQGKGAFLNGKPIKVSTQSELVTALL
VTEAGTKRDQATLNDTTNRINSLLTKVRSLRMSGSCALDLCGVACGRVDIFYELGFGGPWDIAAGIVIVKEAGGLIFDPS
GKDLDITSQRIAASNSSLKELFAEALRLTGA*

DNA
ATGGCGGACAATGATTCTCTAGATCAGTTCTTGGCTGCCGCCATTGATGCCGCTAAAAACGCTGGACAGGTCATTCGTAA
AGGGTTTTACGAGACCAAACATGTTGAACACAAAGGCCAGGTGGATTTGGTGACAGAGACTGATAAAGGATGTGAAGAAC
TCGTGTTTAATCATCTCAAGCAGCTCTTTCCCAATCACAAGTTCATAGGAGAAGAAACTACAGCTGCATACGGTGTGACA
GAACTAACAGACGAACCAACTTGGATTGTTGATCCTCTTGATGGAACAACAAATTTCGTTCACGGGTTCCCTTTTGTGTG
TGTTTCCATTGGACTTACGATTGGAAAAGTCCCTCTGGTTGGCGTTGTTTATAATCCTATTATGGATGAGCTATTCACCG
GTGTCCAAGGGAAAGGAGCATTCTTGAACGGAAAGCCAATTAAAGTGTCAACTCAGAGCGAACTTGTAACCGCTTTGCTC
GTAACAGAGGCGGGTACTAAACGTGATCAAGCTACATTAAATGACACAACCAACAGAATCAACAGTTTGCTAACCAAGGT
TAGGTCCCTTAGGATGAGTGGCTCGTGTGCACTGGACCTCTGTGGCGTTGCGTGTGGAAGGGTTGATATCTTCTATGAAC
TCGGTTTCGGTGGTCCATGGGACATTGCAGCCGGAATTGTAATCGTTAAAGAAGCTGGTGGACTCATTTTTGATCCATCC
GGTAAAGATTTGGACATTACATCGCAGAGGATCGCGGCTTCCAACTCTTCTCTCAAAGAGTTATTCGCAGAGGCGTTGCG
GCTTACAGGGGCATGA