Details for Lyrate rockcress Locus 16042679

Position : sca3 ( 5`- 831440 .. 833713 -3` )
Annotation : [B2G] ATHSFA1E [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042679

Protein [Map View]
MGESVATAVMSSIPPFLSKTYDMVDDPLTDDVVSWSSGNNSFVVWNVPEFAKQFLPKYFKHNNFSSFVRQLNTYGFRKVD
PDRWEFANEGFLRGQKQILKSIVRRKPSQVQPPQQPQVQHSSVGACVEVGKFGLEEEVERLQRDKNVLMQELVRLRQQQQ
VTEHHLQNVGQKVHVMEQRQQQMMSFLAKAVQSPGFLNQFSQQSNDANQHISESNKKRRLPVEDQMNSGSHGVSGLSRQI
VRYQSSMNDATNTMLQQIQQMSNSPSHESLSSNHGSFLLGDVPNSNLSDNGSSSNGSSGVTLADVSSIPAGLYPAMKYHD
PCETNQVLETNLPFSQGDLLPPTQGVAASGSSSSDLVGCETDNGECLDPIMAVLDGAIELEADALNELLPEVQDCFWEQF
IGESPVIGETDELISGSVENELLMEQLELQSGLGSVWSKNQQMNYLTEQMGLLTSDTLRK*

DNA
ATGGGCGAATCTGTAGCGACGGCGGTGATGAGCTCTATCCCGCCTTTTCTGAGCAAAACCTACGATATGGTTGACGATCC
ATTGACGGACGACGTGGTGTCTTGGAGCAGCGGCAACAACAGCTTCGTGGTTTGGAACGTGCCTGAGTTCGCGAAACAGT
TTCTACCAAAGTATTTCAAGCACAACAATTTCTCCAGTTTCGTCAGACAGCTCAATACTTATGGTTTCAGAAAAGTTGAT
CCAGACCGCTGGGAGTTTGCAAATGAGGGCTTTTTAAGAGGCCAAAAACAAATACTAAAGAGTATTGTCCGGCGAAAACC
TTCGCAAGTGCAGCCTCCACAACAACCTCAAGTTCAGCACTCATCTGTGGGTGCGTGCGTTGAAGTGGGCAAATTTGGAC
TCGAAGAAGAGGTGGAAAGACTTCAGAGGGATAAGAACGTCCTTATGCAGGAACTTGTAAGGTTAAGGCAGCAACAACAA
GTTACCGAACATCATCTGCAAAATGTGGGACAGAAAGTTCATGTGATGGAGCAGAGGCAGCAACAAATGATGTCCTTTCT
AGCAAAGGCTGTTCAAAGTCCAGGTTTCTTAAACCAATTTTCCCAGCAGAGTAATGACGCAAACCAACACATTTCTGAAA
GCAACAAAAAGAGGAGGCTACCTGTTGAGGACCAGATGAATTCTGGCAGTCATGGGGTCAGCGGTCTTAGCCGCCAGATT
GTGAGATATCAGTCATCGATGAACGATGCAACAAACACTATGCTCCAACAGATACAACAGATGAGTAATTCACCTAGCCA
TGAATCTCTCTCAAGCAATCATGGCAGCTTTCTTTTGGGCGATGTTCCAAATTCCAACCTTTCAGACAATGGGAGCTCCT
CAAATGGATCATCTGGAGTTACATTGGCAGATGTTTCATCCATTCCTGCAGGCTTATATCCTGCAATGAAGTATCACGAC
CCTTGTGAAACAAATCAAGTCCTGGAGACCAATTTACCTTTTTCTCAAGGTGATCTCTTACCTCCAACGCAAGGAGTAGC
AGCTTCTGGGAGCTCGAGTTCGGATCTTGTTGGATGCGAGACAGATAATGGAGAATGTTTGGATCCAATAATGGCTGTTT
TGGATGGTGCAATCGAACTAGAAGCTGATGCCTTAAATGAGTTGCTTCCTGAAGTCCAAGATTGTTTTTGGGAACAGTTC
ATTGGTGAGAGTCCAGTGATTGGTGAGACAGATGAGCTAATCTCAGGATCAGTGGAAAATGAACTGTTAATGGAGCAGCT
AGAATTACAATCAGGCCTGGGTAGTGTGTGGAGCAAGAACCAACAAATGAACTATCTTACTGAACAGATGGGACTTCTCA
CATCAGATACTCTCAGAAAATGA