Details for Lyrate rockcress Locus 16042677

Position : sca3 ( 5`- 5013047 .. 5015066 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042677

Protein [Map View]
MKMQGELEDEQALNKALRDMHRGPVMSQPRLSLLLLPPQVQELIEELATVEAEILCLEKRIQDLKLDVYSEKKENKELEA
SIDQGEEERMMNPKRLLQRQNHLPCDADNDIIKMRSEDLKHRSKSQSYADHHIVKDIQMNSPRTHASIGSSMEFSSRIHS
STFSDGTSRTQESKNVQETTPNGVSEDLVKCLMGIYLELNRSSREREGSKTVSKLSLTHLKNASFKRKSVYDHNASNLDP
YGAVMGTSLRDIGEYKNFIHITRTSIDVSRLSDCSTSLVNLRVLKEKLSKVDLSFLNHKKKMAFWINTYNACVMNGFLEH
GLPSSKEKLLTILKMATIDVGGTQLSALDIEGSILLSPCEPRESVSAGESEVRIQQRYGFRCVEPNLMFVLCRGDWSSPA
LRVYTAEDVVNELIKARTEYLEASIGVSGRKKIVIPRFLHKRLRDFAEDEGSLIEWICSQLPPVQRCLQLKETAVEWLNK
KGESQLKKMIEVRSHEYEFRYLLPL*

DNA
ATGAAAATGCAAGGAGAGCTAGAGGACGAACAAGCACTAAACAAGGCTCTACGTGATATGCATCGTGGACCCGTCATGTC
TCAGCCTCGTCTCTCTTTACTGCTTCTTCCTCCTCAGGTTCAGGAGCTTATAGAAGAGCTTGCGACGGTTGAGGCAGAGA
TACTCTGTCTTGAGAAACGAATCCAAGACTTGAAACTTGATGTGTATAGTGAGAAAAAAGAGAATAAAGAACTTGAAGCC
AGTATTGATCAAGGAGAAGAAGAGAGGATGATGAATCCTAAGAGACTACTACAAAGGCAGAATCATCTTCCTTGCGACGC
TGACAATGACATTATAAAGATGAGATCTGAGGATCTAAAACACAGATCCAAGTCCCAGAGTTATGCAGATCATCATATTG
TCAAGGATATTCAAATGAACAGTCCTCGTACTCATGCGTCAATTGGATCATCTATGGAGTTCTCATCAAGAATCCATTCT
TCGACTTTTTCTGATGGAACATCAAGAACACAAGAGAGTAAGAATGTGCAAGAGACGACACCAAACGGAGTATCGGAAGA
TCTGGTGAAGTGCTTGATGGGAATCTATCTGGAACTCAACAGGTCTTCGCGTGAACGAGAAGGGTCAAAAACTGTTTCAA
AGCTGAGCCTTACACACCTCAAGAACGCTTCTTTCAAACGCAAATCGGTGTATGACCATAACGCATCGAATCTTGATCCT
TACGGAGCTGTGATGGGGACTTCTCTTAGAGACATAGGAGAGTACAAGAACTTCATCCATATCACTCGAACCTCCATTGA
TGTTAGCCGTTTATCCGATTGCTCCACTTCTCTTGTCAATTTGAGGGTTTTGAAGGAGAAGTTGAGCAAAGTCGATTTGA
GTTTCTTGAACCACAAGAAAAAGATGGCATTCTGGATCAATACCTACAACGCCTGCGTTATGAATGGATTTTTGGAACAC
GGACTACCTTCATCAAAAGAGAAACTACTGACTATTCTGAAAATGGCAACAATTGACGTGGGAGGTACTCAACTGTCTGC
TCTAGATATCGAAGGATCCATCTTGCTGAGTCCATGCGAACCTAGGGAATCTGTTTCAGCCGGTGAAAGCGAAGTAAGAA
TACAGCAACGCTACGGATTCAGATGCGTAGAGCCAAACCTAATGTTCGTGCTTTGTCGTGGAGATTGGTCCTCACCTGCT
TTGAGAGTCTATACAGCAGAAGATGTTGTGAACGAACTAATCAAAGCAAGAACAGAGTATCTAGAAGCTTCCATCGGTGT
ATCGGGAAGGAAAAAGATTGTGATTCCGCGATTCCTGCACAAACGTCTACGGGATTTCGCTGAGGATGAAGGGTCGTTAA
TTGAATGGATATGCAGCCAATTACCACCAGTCCAACGTTGCTTGCAGCTCAAGGAAACAGCGGTCGAGTGGTTGAACAAG
AAAGGTGAATCCCAATTGAAAAAAATGATAGAAGTGAGGTCTCACGAATACGAGTTTCGTTATCTCTTGCCTTTGTAA