Details for Lyrate rockcress Locus 16042659

Position : sca3 ( 5`- 11185080 .. 11184037 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042659

Protein [Map View]
MMEEILLRLPVKSLTRFKCVCSSWRSLISETLFSLKHALILEALKATTSKKSPYGVITTSRYHLKSCCVNSLYNESTVNV
FEHDGELLGRDYYQVVGTCHGLVCFHVDYEKSLYLWNPTIKVQQRLPGSDLETSDDEFVVTYGFGYDESEDDYKVVALLQ
KRHQMKTEAKIYSTRQKLWSSNTCFPSGVVVADKSRSGVYINGTLNWAATSSSSPWTIISYDMSRDEFKQLPGPVYCSRG
CFTMTLGDLRGCLSMVCYCKGANADIWVMKEFGEGESWSKLLSIPGLTDFVRPLWISDGLVVLLEFRSGLALYNCANGGF
QYPVSDSLSGCRDAKVYVKTMVSPNDL*

DNA
ATGATGGAAGAGATTCTCTTAAGACTACCCGTAAAGTCTTTGACGCGTTTCAAATGTGTTTGCAGCTCATGGAGATCTTT
GATCTCAGAGACTCTGTTTTCTCTGAAACACGCTTTGATCTTGGAGGCGTTGAAGGCAACCACTTCCAAGAAGAGTCCTT
ACGGAGTCATCACAACTTCTCGGTACCATCTCAAGTCGTGTTGTGTCAATTCTCTGTACAACGAGTCAACGGTCAACGTT
TTTGAACATGATGGTGAGCTTTTAGGAAGAGATTACTATCAAGTCGTGGGGACTTGTCATGGATTGGTTTGTTTCCACGT
AGATTACGAAAAAAGCCTCTACTTGTGGAACCCAACCATCAAGGTTCAACAAAGATTGCCTGGTTCGGATCTTGAAACGA
GCGATGATGAGTTTGTTGTAACGTATGGGTTTGGTTATGATGAATCTGAAGATGACTATAAAGTGGTTGCATTGTTGCAA
AAAAGACACCAAATGAAGACAGAGGCAAAGATCTACTCAACGAGACAAAAGCTATGGAGTAGCAACACGTGTTTCCCATC
TGGAGTTGTTGTTGCTGACAAATCAAGATCCGGAGTCTACATCAACGGGACACTAAATTGGGCAGCCACTTCCTCATCAT
CACCATGGACCATCATATCATATGATATGTCACGCGATGAGTTCAAACAACTTCCTGGGCCAGTTTATTGTAGCAGAGGA
TGTTTTACAATGACGCTTGGAGATTTGAGAGGATGTCTTTCGATGGTGTGTTATTGCAAAGGAGCTAACGCAGATATTTG
GGTGATGAAGGAGTTTGGAGAAGGAGAATCTTGGTCTAAACTCTTGAGCATTCCTGGTTTGACTGACTTTGTTCGACCGC
TATGGATCTCAGACGGTTTAGTGGTTTTATTGGAGTTTAGATCCGGTTTAGCTCTCTATAACTGTGCCAATGGAGGGTTT
CAGTACCCAGTTTCAGACAGCTTAAGTGGTTGTCGCGACGCCAAAGTTTATGTCAAGACAATGGTTTCTCCAAATGATCT
TTGA