Details for Lyrate rockcress Locus 16042643

Position : sca3 ( 5`- 1966331 .. 1965512 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477821 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042643

Protein [Map View]
MEPSRNSTNSSLFQWLGLLEDSDHPPDSTHPRVITLLASILEKMIQKNKKPFHIRHNKDDEITMFHASKAPTMSIYRYTE
RIHRYAQCSPACFVAAFAYILRYLQRPEATSTARRLTSLNVHRLLITSFLVAAKFLDRKCYNNAYYAKIGGVSTEEMNRL
ERTFLFDIDFRLNITTETFEEHCLMLQKETVPCDSRKLRTVLGEIACSCQAI*

DNA
ATGGAACCTTCTAGAAACTCCACCAACTCATCACTCTTCCAATGGTTAGGTCTTCTAGAAGATTCTGATCATCCTCCTGA
TTCTACCCATCCTCGAGTCATAACCCTTCTCGCTTCTATCCTTGAGAAGATGATCCAGAAGAACAAAAAACCATTCCACA
TAAGACACAACAAGGATGATGAGATCACTATGTTCCATGCCTCAAAAGCACCAACGATGAGCATTTATCGTTACACAGAA
AGAATCCATAGGTATGCTCAGTGTAGCCCTGCGTGCTTCGTTGCAGCTTTTGCTTACATCCTTAGGTATCTACAGAGACC
AGAGGCTACAAGTACGGCTCGTCGTCTCACATCACTCAACGTTCATCGCCTTCTCATTACCAGTTTCTTGGTAGCAGCCA
AGTTCTTGGACCGCAAGTGTTATAACAACGCATATTATGCGAAAATCGGAGGAGTGAGCACTGAAGAGATGAATAGGCTG
GAGAGAACGTTCTTGTTTGATATTGATTTTAGACTAAATATTACAACGGAGACTTTCGAGGAACACTGTCTCATGTTGCA
GAAAGAAACGGTGCCTTGTGATTCGAGAAAACTTAGAACAGTTCTTGGAGAGATAGCTTGTAGCTGCCAAGCGATTTGA